Close

Magic™ Membrane Protein Human TYROBP (Transmembrane immune signaling adaptor TYROBP) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX3675K)

This product is a Human TYROBP membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TYROBP
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Immunity
  • TMD
  • 1
  • Sequence
  • LRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TYROBP
  • Full Name
  • Transmembrane immune signaling adaptor TYROBP
  • Introduction
  • This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.
  • Alternative Names
  • TYROBP; DAP12; KARAP; PLOSL; PLOSL1; TYRO protein tyrosine kinase-binding protein; DNAX adaptor protein 12; DNAX-activation protein 12; KAR-associated protein; TYRO protein tyrosine kinase binding protein; killer-activating receptor-associated protein; polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy; Transmembrane immune signaling adaptor TYROBP

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us