High-affinity immunoglobulin epsilon receptor subunit beta is a protein that in humans is encoded by the MS4A2 gene. MS4A2 is an IgE receptor found on the surface of mast cells and basophils, composed of α, β, and two disulfide-linked γ chains. It recognizes the beta subunit of the high-affinity IgE receptor and binds to the Fc region of immunoglobulin epsilon. In addition, MS4A2 is a member of the membrane-spanning 4A gene family, which shares common structural features.
Basic Information of MS4A2 | |
Protein Name | High-affinity immunoglobulin epsilon receptor subunit beta |
Gene Name | MS4A2 |
Aliases | APY, ATOPY, FCER1B, FCERI, IGEL, IGER, IGHER, MS4A1, membrane spanning 4-domains A2 |
Organism | Homo sapiens (Human) |
UniProt ID | Q01362 |
Transmembrane Times | 4 |
Length (aa) | 244 |
Sequence | MMDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL |
MS4A2 is a high-affinity receptor that binds to the Fc region of immunoglobulin epsilon. It regulates the response of mast cell responses by the aggregation of FCER1 by multivalent antigens, including the release of preformed mediators (such as histamine) by degranulation and de novo production of lipid mediators and cytokines. MS4A2 also mediates the secretion of important lymphokines. In addition, it also regulates allergic disease signaling pathways by binding of allergens to receptor-bound IgE, resulting in activation of cells and release of mediators that cause allergic manifestations. Moreover, MS4A2 is expressed on the surface of mast cells and basophils and shows a unique expression pattern in hematopoietic and non-lymphoid tissues. Several variants within MS4A gene cluster have been implicated the association of Alzheimer's disease (AD) by serial recent genome-wide association studies (GWAS). As a cell membrane protein, MS4A2 has been also found to be involved in the regulation of calcium signaling, which has been extensively discussed in neurodegeneration and AD.
Fig.1 The proposed roles of MS4A2 in mast cell function. (Bradding, 2015)
The study investigated the methylation patterns of key genes in the allergic cascade including the transmembrane 4-domains, subfamily A, and member 2 genes (MS4A2), and analyzed its role in allergic diseases.
The authors found that the high-affinity IgE receptor, FcrepsilonRI, on basophils and mast cells initiated cascades of biochemical events leading to degranulation, membrane ruffling and other physiological responses, which offers a new idea for developing new targets for the treatment of allergies and asthma.
This report demonstrated that phosphorylation of SLP-76 required Syk activity, but did not rely on Ca2+ mobilization, and that SLP-76 and its associated proteins may be involved in signaling events in multiple cell types in the immune system.
The article suggested that PU.1 and GATA1 participated in FcεRIα transcription by recruiting its promoters and GATA2 positively regulates FcεRIβ transcription. Inhibition of these transcription factors results in the down-regulated FcεRI expression and IgE-mediated degranulation activity.
The authors summarized the structure, localization, and function of the MS4A gene cluster, reviewed the recent genetic and expression findings of the MS4A gene cluster associated with the pathogenesis of AD, and speculated on the possible role of the MS4A gene cluster in this disease.
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, we also provide customized anti-MS4A2 antibody development services based on our versatile Magic™ anti-membrane protein antibody discovery platform.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.