Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsCreative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsCreative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsCreative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications.
HighlightsCreative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsReceptor Activity Modification Protein 1 (RAMP1) is a protein encoded by RAMP1 gene in humans. It is a member of the RAMP family, which are also known as single-transmembrane domain proteins called receptor (calcitonin) activity-modifying proteins (RAMPs). RAMP1 is a type I transmembrane protein consist of an extracellular N-terminus and a cytoplasmic C-terminus.
| Basic Information of RAMP1 | |
| Protein Name | Receptor activity-modifying protein 1 |
| Gene Name | RAMP1 |
| Aliases | Calcitonin-receptor-like receptor activity-modifying protein 1 (CRLR activity-modifying protein 1) |
| Organism | Homo sapiens (Human) |
| UniProt ID | O60894 |
| Transmembrane Times | 1 |
| Length (aa) | 148 |
| Sequence | MARALCRLPRRGLWLLLAHHLFMTTACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV |
RAMP1 is required to transport the calciton receptor-receptor (CALCRL) onto the plasma membrane. CALCRL is a receptor with seven transmembrane domains that can act as a calcitonin gene-related peptide (CGRP) receptor or adrenergic receptor, depending on how members of the slope family are expressed. In combination with RAMP proteins, CALCRL acts as a CGRP receptor. RAMPs have been shown to interact with g-protein-coupled receptors such as the calcitonin receptor, vasoactive intestinal peptide receptor (VIPR), calcitonin receptor, calcium-sensing receptor, parathyroid hormone receptor, high Glucagon receptor and corticotropin releasing factor receptor 1 to regulate their trafficking, pharmacological properties and signaling capabilities.
Fig.1 The structure of Receptor activity-modifying protein 1.
This article shows that the interface of the ramp-receptor is pharmacologically treatable, suggesting that it may be possible to develop compounds directed to the RAMP1/CLR interface to aid in the treatment of asthma.
These data provide new insights into the role of RAMP1 in promoting prostate tumorigenesis and support the possibility of being a new biomarker and a potential therapeutic target in prostate cancer.
This study provides the first evidence that DNA methylation of RAMP1 promoters may play a role in migraine.
These results demonstrate the co-evolution of global GPCRs and RAMPs and support the hypothesis that GPCRs interact globally with RAMPs on cellular signaling pathways.
This review covers recent discoveries in the field of RAMPs and summarizes the capabilities of known GPCR partners and RAMPs.
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-RAMP1 antibody development services.
Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
