RAMP3 Membrane Protein Introduction

Introduction of RAMP3

Receptor Activity Modification Protein 3, also known as RAMP3, is a protein which is encoded by RAMP3 gene. It is also named as Calcitonin-receptor-like receptor activity-modifying protein 3 (CRLR activity-modifying protein 3). The RAMP3 is a member of the RAMPs family of single-transmembrane domain proteins. Ramps are type I transmembrane proteins with an extracellular N-terminus and a cytoplasmic C-terminus. CRLR is a receptor with seven transmembrane domains that can act as a calcitonin gene-related peptide (CGRP) receptor or adrenergic receptor, depending on how members of the RAMP family are expressed. In humans and other mammals, there are 3 RAMPS, and in fish, there are more sub-mutations. In the presence of this (RAMP3) protein, CRLR acts as an adrenergic receptor with a lower affinity for CGRP.

Basic Information of RAMP3
Protein Name	Receptor activity-modifying protein 3
Gene Name	RAMP3
Aliases	Calcitonin-receptor-like receptor activity-modifying protein 3 (CRLR activity-modifying protein 3)
Organism	Homo sapiens (Human)
UniProt ID	O60896
Transmembrane Times	1
Length (aa)	148
Sequence	METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

Function of RAMP3 Membrane Protein

The RAMP family consists of three proteins (RAMPs 1-3) that share similar molecular mass (160 amino acids) and structure, but the requirements for sequence homology, tissue distribution, and normal embryo development vary. RAMP3 is caused by estrogen, which contains a functional estrogen receptor response element in its promoter. Ramps are required to transport the calcitonin-receptor (CRLR) receptor (CRLR) onto the plasma membrane.

Fig.1 The structure of Receptor activity-modifying protein 3.

Application of RAMP3 Membrane Protein in Literature

Chauhan M.H., et al. Involvement of Receptor Activity-Modifying Protein 3 (RAMP3) in the Vascular Actions of Adrenomedullin in Rat Mesenteric Artery Smooth Muscle Cells. Biology of Reproduction. 2015, 93 (5): 116. PubMed ID: 26423127

This study shows that ADM increases the association between CALCL and RAMP3, while the knockout of RAMP3 suppresses the interaction between ADM and CALCRL.
Watkins H. A., et al. Receptor Activity-Modifying Proteins 2 and 3 Generate Adrenomedullin Receptor Subtypes with Distinct Molecular Properties. The Journal of Biological Chemistry. 2016, 291 (22): 11657–11675. PubMed ID: 27013657

These results indicate that the interaction of RAMP2 or RAMP3 with CLR induces conformational variation in the juxtamembrane region, yielding distinct binding pockets, probably via an allosteric mechanism.
Barbash S., et al. GPCRs Globally Coevolved with Receptor Activity-Modifying Proteins, RAMPs. Proceedings of the National Academy of Sciences of the United States of America. 2017,114 (45): 12015–12020. PubMed ID: 29078385

These results indicate that in the membrane proximal region, the interaction of RAMP2 or RAMP3 and CLR results in a conformational change in the membrane proximal region, resulting in a distinct binding pocket, possibly through an allosteric mechanism.
Watkins H. A., et al. Receptor Activity-Modifying Protein-Dependent Effects of Mutations in the Calcitonin Receptor-like Receptor: Implications for Adrenomedullin and Calcitonin Gene-Related Peptide Pharmacology. British Journal of Pharmacology. 2014,171 (3): 772–788. PubMed ID: 24199627

The study reveals that compared to RAMP1 and RAMP2, the role of RAMP3's specific residue on the clr-RAMP interface seems to change.
Barrick C.J., et al. Loss of Receptor Activity-Modifying Protein 3 Exacerbates Cardiac Hypertrophy and Transition to Heart Failure in a Sex-Dependent Manner. Journal of Molecular and Cellular Cardiology. 2012, 52 (1): 165–174. PubMed ID: 22100352

These data show the dependence of RAMP3 in the context of chronic hypertension, sexual dependence, cardiovascular protection.

RAMP3 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-RAMP3 antibody development services.

Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: