RHAG Membrane Protein Introduction

Introduction of RHAG

The Ammonium transporter Rh type A (RHAG) is a membrane protein encoded by the RHAG gene in humans. In addition, RHAG has recently been designated as CD241 (Differentiated Cluster 241). Mutations in the RHAG gene result in increased stomata. RHAG is associated with the expression of the Ganges blood group antigen. RHAG may be part of an oligomeric complex that is possible to have a transport or channel function on the erythrocyte membrane. RHAG is in the process of ammonia transport on the erythrocyte membrane. It seems to play a role in monovalent cation transport.

Basic Information of RHAG
Protein Name	Ammonium transporter Rh type A
Gene Name	RHAG
Aliases	Erythrocyte membrane glycoprotein Rh50, Erythrocyte plasma membrane 50 kDa glycoprotein (Rh50A), Rhesus blood group family type A glycoprotein (Rh family type A glycoprotein, Rh type A glycoprotein), Rhesus blood group-associated ammonia channel, Rhesus blood group-associated glycoprotein, CD_antigen: CD241
Organism	Homo sapiens (Human)
UniProt ID	Q02094
Transmembrane Times	12
Length (aa)	409
Sequence	MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFELYPLFQDVHVMIFVGFGFLMTFLKKYGFSSVGINLLVAALGLQWGTIVQGILQSQGQKFNIGIKNMINADFSAATVLISFGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFGAYFGLAVAGILYRSGLRKGHENEESAYYSDLFAMIGTLFLWMFWPSFNSAIAEPGDKQCRAIVNTYFSLAACVLTAFAFSSLVEHRGKLNMVHIQNATLAGGVAVGTCADMAIHPFGSMIIGSIAGMVSVLGYKFLTPLFTTKLRIHDTCGVHNLHGLPGVVGGLAGIVAVAMGASNTSMAMQAAALGSSIGTAVVGGLMTGLILKLPLWGQPSDQNCYDDSVYWKVPKTR

Function of RHAG Membrane Protein

The Rh blood group antigen (MIM 111700) is associated with human erythrocyte membrane proteins, approximately 30 kD, the so-called Rh30 polypeptide. The allogeneic glycosylation membrane protein, approximately 50 or 45 kD, Rh50 glycoprotein, binds to the Rh30 polypeptide under immunoprecipitation, with anti-r specific cells and polyclonal antibodies. The Rh antigen appears to be present in the multi-subunit complex of LW (MIM 111250), saccharin B (MIM 111740), CD47 (MIM 601028). In addition, RHAG may play a key role in the Rh50 glycoprotein.

RHAG Membrane Protein Introduction Fig.1 The structure of Protein Ammonium transporter Rh type A.

Application of RHAG Membrane Protein in Literature

Ma N., et al. Low Temperature-Induced DNA Hypermethylation Attenuates Expression of RhAG, an AGAMOUS Homolog, and Increases Petal Number in Rose (Rosa Hybrida). BMC Plant Biology. 2015, (15): 237. PubMed ID: 26438149

These results show that epigenetic DNA methylation plays a key role in the increase in ambient temperature regulation of RHAG expression.
Satchwell T.J., et al. Severe Ankyrin-R Deficiency Results in Impaired Surface Retention and Lysosomal Degradation of RhAG in Human Erythroblasts. Haematologica. 2016,101 (9): 1018-1027. PubMed ID: 27247322

This article reveals that identification of significantly reduced surface expression of Rh/RhAG combined with flow cytometry provides an effective and rapid method for the direct evaluation of anchorage protein expression, which can be used to classify hereditary spherocytosis caused by the absence of anchor protein.
Goossens D., et al. Mice Expressing RHAG and RHD Human Blood Group Genes. PLoS ONE. 2013, 8 (11): e80460. PubMed ID: 24260394

In this study, RhD has never been observed separately, strongly suggesting that its expression is completely dependent on the presence of transgenic human RHAG.
Stewart A.K., et al. Loss-of-Function and Gain-of-Function Phenotypes of Stomatocytosis Mutant RhAG F65S. American Journal of Physiology - Cell Physiology. 2011, 301 (6): C1325-C1343. PubMed ID: 21849667

These results indicate that altered oocyte pH, current associated with RHAG or RHAG F65S expression and membrane potential may reflect different transport mechanisms.
Shmukler B.E., et al. Cation-Leak Stomatocytosis in Standard Schnauzers Does Not Cosegregate with Coding Mutations in the RhAG, SLC4A1, or GLUT1 Genes Associated with Human Disease. Blood cells, molecules & diseases. 2012, 48 (4): 219-225. PubMed ID: 22406315

It is concluded that, unlike humans with excessive water hyperplasia, in this standard group of Schnauzers, lipoblastosis is not caused by mutations in the gene-encoded RHAG, SLC4A1 or glutamine.

RHAG Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Besides, aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-RHAG antibody development services.

Creative Biolabs' skillful scientists are glad to leverage our expertise and advanced technologies to help you with the member protein research. If you are interested, please feel free to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: