ADGRL1 Membrane Protein Introduction

Introduction of ADGRL1

ADGRL1, also known as Calcium-independent alpha-latrotoxin receptor 1 or Latrophilin-1 (LPHN1), is a protein encoded by the human ADGRL1 gene. As a member of the novel family of G protein-coupled receptors which previously thought to be brain-specific, ADGRL1 is characterized by an extended extracellular region with a variable number of protein domains coupled to a TM7 domain via a domain known as the GPCR-Autoproteolysis INducing (GAIN) domain.

Basic Information of ADGRL1
Protein Name	Adhesion G protein-coupled receptor L1
Gene Name	ADGRL1
Aliases	Calcium-independent alpha-latrotoxin receptor 1, CIRL-1, Latrophilin-1, Lectomedin-2
Organism	Homo sapiens (Human)
UniProt ID	O94910
Transmembrane Times	7
Length (aa)	1474
Sequence	MARLAAVLWNLCVTAVLVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVENANYGRTDDKI CDADPFQMENVQCYLPDAFKIMSQRCNNRTQCVVVAGSDAFPDPCPGTYKYLEVQYDCVPYKVEQKVFVC PGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWIPYRTDTLTEYASWEDYVAARHTTTYRLPNR VDGTGFVVYDGAVFYNKERTRNIVKYDLRTRIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVI YATEGNNGRLVVSQLNPYTLRFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNT NANREEPVSLTFPNPYQFISSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPT PLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPVPSTRRPPAPNLHVSPELFCEPREVRRVQW PATQQGMLVERPCPKGTRGIASFQCLPALGLWNPRGPDLSNCTSPWVNQVAQKIKSGENAANIASELARH TRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAGKNYNKMHKRERTCKDYIKAVVETVDNLLRP EALESWKDMNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAAKENVVLEVTVLNTEGQVQELVFPQE EYPRKNSIQLSAKTIKQNSRNGVVKVVFILYNNLGLFLSTENATVKLAGEAGPGGPGGASLVVNSQVIAA SINKESSRVFLMDPVIFTVAHLEDKNHFNANCSFWNYSERSMLGYWSTQGCRLVESNKTHTTCACSHLTN FAVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCINLFLAELLF LVGIDKTQYEIACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYSRTKYYYLGGYCFPALVVGI AAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLVFLMVTLHKMIRSSSVLKPDSSRLDNIKSWA LGAIALLFLLGLTWAFGLLFINKESVVMAYLFTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIR SPPGGTHGSLKTSAMRSNTRYYTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLTNPV LQPRGGTSPYNTLIAESVGFNPSSPPVFNSPGSYREPKHPLGGREACGMDTLPLNGNFNNSYSLRSGDFP PGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGSSSAAKGPPPPEPPVPPVPGGGGEEEAGGPGGADR AEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDGATSRPLSSPPGRDSLYASGANLRDSPSYPDS SPEGPSEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGYYQVRRPSHEGYLAAPGLEGPGPDGDGQMQL VTSL

Function of ADGRL1 Membrane Protein

ADGRL1 (calcium-independent receptor of a-latrotoxin) is a neuronal G protein-coupled receptor with the large N-terminal ectodomain containing mosaics of cell adhesion modules. It was originally discovered as a target of potent presynaptic neurotoxin, latrotoxin, and has been shown to regulate secretion. Studies have shown that ADGRL1 consists of two heterologous subunits, p120 which is an extracellular hydrophilic polypeptide and p85 - a heptahelical membrane protein. Both CIRL-1 subunits are encoded by one gene and derive from proteolytically processed receptor precursor. Moreover, ADGRL1 is associated with the processes of cell adhesion and signal transduction. It has also been reported that ADGRL1 is involved in the release of hormones, including the release of neurotransmitters from sensory and motor neurons, and also for the release of insulin from endocrine cells.

Fig.1 Crystal structure of the GAIN and HormR domains of Latrophilin 1.

Application of ADGRL1 Membrane Protein in Literature

1. Deyev IE., Petrenko AG. Regulation of CIRL-1 proteolysis and trafficking. Biochimie. 2010, 92(4): 418-22. PubMed ID: 20100540

This article suggests that the GPS proteolysis of CIRL-1 is not a purely autocatalytic process and may involve auxiliary proteins or factors that become available in the course of CIRL-1 trafficking.

2. Zuko A., et.al. Association of cell adhesion molecules contactin-6 and latrophilin-1 regulates neuronal apoptosis. Frontiers in molecular neuroscience. 2016, 9: 143. PubMed ID: 28018171

This article suggests that the cell adhesion molecule contactin-6 (Cntn6) can modulate the activity of Lphn1 by direct binding and indicates that Cntn6 may prevent apoptosis thereby impinging on neurodevelopment.

ADGRL1 Preparation Options

Having worked in the field for many years, we have gained a wealth of experience which enables us to provide high-quality membrane protein preparation service for global customers. With advanced Magic™ membrane protein production platform and professional scientists, we can help our client find the most suitable reconstitution form in multiple active formats. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADGRL1 antibody development services.

Working on membrane proteins for years, Creative Biolabs is always ready to help you with our first-class membrane protein synthesis, reconstitution, purification and characterization services. In addition to membrane protein preparation for ADGRL1, we also provide other services in solubilization/reconstitution of membrane proteins in liposomes, nanodiscs, and amphipols. For more details, please feel free to contact us.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: