ADRA1B Membrane Protein Introduction

Introduction of ADRA1B

Alpha-1-adrenergic receptor (alpha-1-ARs) is a member of the G protein-coupled receptor superfamily. 3 alpha-1-AR subtypes are divided into alpha1A, alpha1B, and alpha1D receptors. All subtypes signal through the Gq/11 family of G-proteins but show different patterns of activation. They activate mitogenic responses and regulate growth and proliferation of many cells. Adrenoceptor Alpha 1B (ADRA1B) is encoded by the gene ADRA1B. ADRA1B is regulated by Alpha-1 adrenergic receptors and Monoamine GPCRs. Gene Ontology annotations related to ADRA1A include alpha1-adrenergic receptor activity and G-protein coupled receptor activity.

Basic Information of ADRA1B
Protein Name	Alpha-1B adrenergic receptor
Gene Name	ADRA1B
Aliases	Alpha-1B adrenoreceptor, Alpha-1B adrenoceptor
Organism	Homo sapiens (Human)
UniProt ID	P35368
Transmembrane Times	7
Length (aa)	520
Sequence	MNPDLDTGHNTSAPAHWGELKNANFTGPNQTSSNSTLPQLDITRAISVGLVLGAFILFAI VGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLGYWVLGRIFCDI WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFV RILGCQCRGRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRT LPSASPSPGYLGRGAPPPVELCAFPEWKAPGALLSLPAPEPPGRRGRHDSGPLFTFKLLT EPESPGTDGGASNGGCEAAADVANGQPGFKSNMPLAPGQF

Function of ADRA1B Membrane Protein

Upon agonist stimulation, ADRA1B couple to Gq proteins, calcium signaling and protein kinase C activation. Subsequently, the receptors are phosphorylated, desensitized, and internalized. ADRA1B contributes to vasoconstriction in humans. Alpha1A adrenergic receptors are the prime mediators of vasoconstriction induced by activation of the sympathetic nervous system and thus play an important role in blood pressure regulation. Among the α1- AR- pathway genes, variants in the α1B-AR were most significantly associated with blood pressure and hypertension, while variants in the α1A-AR were not, suggesting that genetic variants in the α1B-AR, rather than in the α1A-AR subtype, may contribute to interindividual variability in regulation of vascular tone and blood pressure control.

Fig.1 The adrenergic receptors which subserve the responses of the sympathetic nervous system have been divided into two discrete subtypes: alpha adrenergic receptors and beta adrenergic receptors.

Application of ADRA1B Membrane Protein in Literature

1. Alfonzo-Méndez MA., et al. Protein Kinase C Activation Promotes α1B-Adrenoceptor Internalization and Late Endosome Trafficking through Rab9 Interaction. Role in Heterologous Desensitization. Mol Pharmacol. 2017, 91(4): 296-306. PubMed ID: 28082304

This article reports that protein kinase C regulates the transfer of α_1B-adrenergic to late endosomes and that Rab9 regulates this process and is involved in G protein-mediated signaling turn-off.

2. Adefurin A., et al. Genetic variation in the alpha1B-adrenergic receptor and vascular response. Pharmacogenomics J. 2016, 17(4): 366-371. PubMed ID: 27089938

Authors in this group verified that ADRA1B rs10070745 was significantly associated with vasoconstrictor responses after adrenergic stimulation and contributed to the ethnic difference in phenylephrine sensitivity.

3. Tanaka K., et al. α1B-Adrenoceptor signalling regulates bone formation through the up-regulation of CCAAT/enhancer-binding protein δ expression in osteoblasts. Br J Pharmacol. 2016, 173(6): 1058-69. PubMed ID: 26750808

The result indicates that α_1B-adrenoceptor signaling is essential for bone formation and regulates cellular proliferation through mechanisms associated with the up-regulation of Cebpd in osteoblasts.

4. Böhmer T., et al. The α₁B-adrenoceptor subtype mediates adrenergic vasoconstriction in mouse retinal arterioles with damaged endothelium. Br J Pharmacol. 2014, 171(16): 3858-67. PubMed ID: 24749494

Authors in this group demonstrate that α₁-adrenoceptor-mediated vasoconstriction in murine retinal arterioles is buffered by the endothelium. The α_1B-adrenoceptor may represent a target that selectively regulates retinal blood flow in ocular diseases associated with endothelial dysfunction.

5. Castillo-Badillo JA., et al. Sphingosine 1-phosphate-mediated α1B-adrenoceptor desensitization and phosphorylation. Direct and paracrine/autocrine actions. Biochim Biophys Acta. 2012, 1823(2): 245-54. PubMed ID: 22019450

This article reveals that S1P is able to induce α_1B-adrenergic receptor internalization and that its autocrine/paracrine generation was relevant for internalization induced by IGF-I.

ADRA1B Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADRA1B antibody development services.

As a world-leading member protein provider, Creative Biolabs now provides all-around, custom-oriented membrane protein preparation services. We are happy to leverage our advanced techniques and extensive expertise in this field to satisfy every single custom demand. If you are interested, please do not hesitate to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: