ADRA1D Membrane Protein Introduction

Introduction of ADRA1D

Alpha-1-adrenergic receptor (alpha-1-ARs) is a member of the G protein-coupled receptor superfamily. 3 alpha-1-AR subtypes are divided into alpha1A, alpha1B and alpha1D receptors. All subtypes signal through the Gq/11 family of G-proteins but show different patterns of activation. They activate mitogenic responses and regulate growth and proliferation of many cells. Adrenoceptor Alpha 1B (ADRA1D) is encoded by the gene ADRA1D. ADRA1D is regulated by Alpha-1 adrenergic receptors and Monoamine GPCRs. Gene Ontology annotations related to ADRA1A include alpha1-adrenergic receptor activity and G-protein coupled receptor activity.

Basic Information of ADRA1D
Protein Name	Alpha-1D adrenergic receptor
Gene Name	ADRA1D
Aliases	Alpha-1A adrenergic receptor, Alpha-1D adrenoreceptor, Alpha-1D adrenoceptor, Alpha-adrenergic receptor 1a, ADRA1A
Organism	Homo sapiens (Human)
UniProt ID	P25100
Transmembrane Times	7
Length (aa)	572
Sequence	MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE AVSLGVPHEVAEGATCQAYELADYSNLRETDI

Function of ADRA1D Membrane Protein

Currently, 1-adrenoceptors are divided into three recognizable subtypes (1A, 1B, and 1D), and the importance of 1D -adrenoceptor subtypes in the overall control of micturition has been clinically established. 1D-Adrenoceptors are the predominant receptor subtype (present at twice the level of the other 1-subtypes) in sacral ventral motor neurons and autonomic parasympathetic pathways. It has been shown that blocking of the 1D-adrenoceptor subtype reduces the urethral resistance associated with Detrusor-sphincter dyssynergia, leading to the improvement in voiding efficiency in spinal cord injury (SCI) rats. These results suggest that 1D-blockers may be effective for treating storage and voiding symptoms in SCI patients.

Alpha 1 adrenergic receptors Creative Biolabs. Fig.1 Alpha-1-adrenergic receptors.

Application of ADRA1D Membrane Protein in Literature

1. Ishida H., et al. α1D-Adrenoceptor blockade increases voiding efficiency by improving external urethral sphincter activity in rats with spinal cord injury. Am J Physiol Regul Integr Comp Physiol. 2016, 311(5): R971-R978. PubMed ID: 27605559

Authors in this group investigated blockade of various α-adrenoceptors to determine the subtype that was principally responsible for improving the voiding dysfunction. Data shows that α1D-Adrenoceptor blockade increases urinary excretion efficiency via improving the activity of extra-urethral sphincter in rats with spinal cord injury.

2. Alfonzo-Méndez MA., et al. Carboxyl terminus-truncated α1D-adrenoceptors inhibit the ERK pathway. Naunyn Schmiedebergs Arch Pharmacol. 2016, 389(8): 911-20. PubMed ID: 27146292

The article reports that the absence of the human α1D-adrenoceptor carboxyl tail results in altered ERK (extracellular signal-regulated kinase) and p38 phosphorylation states.

3. Colciago A., et al. A selective alpha1D-adrenoreceptor antagonist inhibits human prostate cancer cell proliferation and motility "in vitro". Pharmacol Res. 2016, 103: 215-26. PubMed ID: 26621245

The results reveal some cellular aspects promoted by alpha1D-AR activity modulation. The selective alpha1D-adrenoreceptor antagonist is capable of inhibiting human prostate cancer cell proliferation and motility.

4. Kandasamy K., et al. Erythropoietin Reverses Sepsis-Induced Vasoplegia to Norepinephrine Through Preservation of α1D-Adrenoceptor mRNA Expression and Inhibition of GRK2-Mediated Desensitization in Mouse Aorta. J Cardiovasc Pharmacol Ther. 2016, 21(1): 100-13. PubMed ID: 26025460

Authors in this group investigated the effect of erythropoietin (EPO) posttreatment on survival time and vascular functions in a mouse model of sepsis. Erythropoietin significantly preserved the α1D receptor expression and restored NE-induced contractions to control levels in septic mice.

5. Morelli MB., et al. Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation. BMC Cancer. 2014, 14: 921. PubMed ID: 25481381

This article reveals a cross-talk between alpha1D-AR and transient receptor potential vanilloid type 1 (TRPV1). It shows that the cross-talk between alpha1D-AR and TRPV1 triggers prostate cancer cell proliferation.

ADRA1D Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-ADRA1D antibody development services.

As an expert who can provide professional custom service in membrane proteins, Creative Biolabs is happy to leverage our advanced techniques and extensive expertise in this field to satisfy every single custom demand. If you are interested, please do not hesitate to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: