CCR-5 Membrane Protein Introduction

Introduction of CCR-5

CCR-5 (designated as CD195), is a membrane receptor protein encoded by CCR5 gene which is found in human immune cells such as monocytes and lymphocytes. CCR-5 is highly expressed in spleen, thymus, in the myeloid cell line THP-1, in the promyeloblastic cell line KG-1a and on CD4⁺ and CD8⁺ T-cells. It belongs to the G-protein-coupled receptor family, which is involved in the immune system as it functions as a receptor for chemokines. CCR-5 is a receptor for several inflammatory CC chemokines including MIP-1-alpha, MIP-1-beta, and RANTES.

Basic Information of CCR-5
Protein Name	C-C chemokine receptor type 5
Gene Name	CCR-5
Aliases	CHEMR13, HIV-1 fusion coreceptor, CD195, CC-CKR-5
Organism	Homo sapiens (Human)
UniProt ID	P51681
Transmembrane Times	7
Length (aa)	352
Sequence	MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLL NLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKAR TVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVM VICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQ VTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISV GL

Function of CCR-5 Membrane Protein

As binding with its various ligands, CCR-5 subsequently transduces a signal by up-regulating the intracellular calcium ion level. This receptor may also play a role in the control of granulocytic lineage proliferation or differentiation. CCR-5 acts as a co-receptor of HIV R5 isolates, which causes AIDS. It cooperates with the host cellular CD4 protein (the primary receptor for HIV) to permit the initial docking of the HIV virus onto T-cells and subsequent infection. The CD4 bound HIV envelope spike protein to utilize CCR-5 as a co-receptor to enter and infect host cells. Consequently, CCR5 antagonist development has suggested to be a very effective therapeutic method. CCR-5 has also been regarded as an essential node in the bidirectional communication between breast cancer and normal cells. Specifically, the CCL5/CCR5 axis is involved in the recruitment of specific immune cells into tumors, inducing local immunosuppression and promoting tumor progression, which supports the use of CCR5 antagonists in breast cancer patients as adjuvant therapy to block the metastasis.

CCR 5 Membrane Protein Introduction

Application of CCR-5 Membrane Protein in Literature

1. Jin J., et al. CCR5 adopts three homodimeric conformations that control cell surface delivery. Sci Signal. 2018, 1(529). pii: eaal2869. PubMed ID: 29739880

This article suggests that dimerization of CCR5 contributes to the conformational diversity of inactive class A GPCRs and may provide new opportunities to investigate the cellular entry of HIV-1 and mechanisms for its inhibition.

2. Wu Y.C., et al. Autocrine CCL5 promotes tumor progression in esophageal squamous cell carcinoma in vitro. Cytokine. 2018, 110: 94-103. PubMed ID: 29705397

This article focused on the pro-tumoral effects of CCL5 and reveals that that CCL5 autocrine loop may promote ESCC progression; targeting the CCL5/CCR5 axis could be a potential therapeutic strategy for this deadly disease.

3. Lee D., et al. CCL4 enhances preosteoclast migration and its receptor CCR5 downregulation by RANKL promotes osteoclastogenesis. Cell Death Dis. 2018, 9(5): 495. PubMed ID: 29717113

Authors in this group we investigated the function of CCL4 and its receptor CCR5 during osteoclastogenesis and the results indicated that CCL4 can enhance the recruitment of preosteoclasts to bones in the early stage, and the reduction of CCR5 promotes osteoclastogenesis when RANKL is prevalent.

4. Petti L.M., et al. Regulation of C-C chemokine receptor 5 (CCR5) stability by Lys-197 and by transmembrane protein aptamers that target it for lysosomal degradation. J Biol Chem. 2018, pii: jbc.RA117.001067. PubMed ID: 29678881

This article focuses on the mechanism of traptamer-mediated CCR5 down-regulation and shows that most of the traptamers (designated class 1 traptamers) form a stable complex with CCR5 and target it for lysosome-mediated degradation.

5. Hütter G., et al. CCR5 Targeted Cell Therapy for HIV and Prevention of Viral Escape. Viruses. 2015, 7(8): 4186-203. PubMed ID: 26225991

This article focuses on the current knowledge of inhibition of CCR5 specifically and whether this approach allows for consequent viral escape.

CCR-5 Preparation Options

To obtain the soluble and functional target protein, we present robust reconstitution forms as well as multiple active formats for membrane proteins. Our versatile Magic™ membrane protein production platform enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CCR-5 antibody development services.

Creative Biolabs has worked all out in the field of membrane protein preparation to support membrane protein studies. We are recognized as the world leader in providing the largest and most diverse portfolio of standard and custom professional membrane protein preparation services. Please feel free to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: