Introduction of CHRM2
CHRM2, encoded by CHRM2 gene, is a member of G protein-coupled receptors family which has seven distinctive transmembrane domains. It is one of the five subtypes of muscarinic receptors (CHRM1-5), selectively expressed in various human tissues, including heart, gallbladder, and 3 other tissues. Research have found that muscarinic receptors are the potential therapeutic targets for a variety of pathological conditions, especially in neurodegenerative disorders.
Basic Information of CHRM2 | |
Protein Name | Muscarinic acetylcholine receptor M2 |
Gene Name | CHRM2 |
Aliases | HM2 |
Organism | Homo sapiens (Human) |
UniProt ID | P08172 |
Transmembrane Times | 7 |
Length (aa) | 466 |
Sequence |
MNNSTNSSNNSLALTSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKDKKEPVANQDPVSPSLVQGRI VKPNNNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDE ITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSSGQNGDEKQNI VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR |
Function of CHRM2 Membrane Protein
CHRM2 can bind acetylcholine thereby regulating various cellular responses, including the decrease of cAMP, phosphoinositide degeneration as well as potassium channels mediation. Moreover, it plays a critical role in a great number of important central and peripheral physiological and pathophysiological processes. It has been shown that CHRM2 is involved in the mediation of bradycardia and a decrease in cardiac contractility. Besides, CHRM2 plays a key role in facilitating cognitive processes. The deficiency of CHRM2 in mice may present deficits in behavioral flexibility, working memory, and hippocampal plasticity. And multiple SNPs across CHRM2 are associated with adult performance IQ. In addition, the discoveries show that CHRM2 is associated with the progression of multiple diseases, such as Alzheimer disease, familial dilated cardiomyopathy, early adolescents’ depression, and asthma. These also suggest that CHRM2 can be considered as a potential therapeutic target for many diseases treatment.
Fig.1 The structure of CHRM2.
Application of CHRM2 Membrane Protein in Literature
The research confirms that Feishu acupuncture can relieve allergic asthma. The mechanisms may be involved in the suppression of the Ach signal both from its synthesis and during its release.
The study reveals that a genetic-risk score (GRS) of 9 SNPs in CHRM2, CHRM3, HTR3C, HTR7, ABCB1, OPRM1, and TPH1 was associated with anticholinergic symptoms in a generalized linear univariate model, with body mass index, clozapine monotherapy, and GRS as explaining variables (permuted P = 0.014).
The researcher implicates that N-8-Iper is an M2 activator which produces a cytotoxic and promotes the cell apoptosis at low concentrations. These also suggest that M2 activator may be a promising therapeutic agent for glioblastoma cancer treatment.
The article investigates the association between SNPs in CHRM1, CHRM2 and CHRM3 and autonomic nervous system (ANS) activity. The results show that the CHRM2 rs8191992 polymorphism in patients with schizophrenia on high-dose antipsychotics decreases ANS activity.
The study identifies that the CHRM2 rs1824024 polymorphism is significantly associated with the severity of chronic obstructive pulmonary disease and it decreases lung function test values, gives rise to frequent exacerbations, and is a poor response to anticholinergic drugs.
CHRM2 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CHRM2 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.