CYSLTR2 Membrane Protein Introduction

Introduction of CYSLTR2

CysLTR2 is encoded by the CysLTR2 gene and is a receptor for cysteinyl leukotrienes. It belongs to the G-protein-coupled receptor (GPCR) family which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. The cysteinyl leukotrienes LTC4, LTD4, and LTE4 are important mediators of human bronchial asthma. Pharmacologic studies have determined that cysteinyl leukotrienes activate at least 2 receptors, the protein encoded by this gene and CYSLTR1. It seems to play a major role in endocrine and cardiovascular systems.

Basic Information of CysLTR2
Protein Name	Cysteinyl leukotriene receptor 2
Gene Name	CYSLTR2
Aliases	HG57, CYSLT2, GPCR21, HPN321, CYSLT2R, KPG_011, hGPCR21, PSEC0146
Organism	Homo sapiens (Human)
UniProt ID	Q9NS75
Transmembrane Times	7
Length (aa)	346
Sequence	MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKS TSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAM VHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGC LLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCK DRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV

Function of CYSLTR2 Membrane Protein

The CysLT-induced activation of CysLTR2 induces many of the same in vitro responses of cells involved in allergic reactions as well as the in vivo allergic responses in animal models as that induced by CysLT-induced CysLTR1. Via a G-protein, the response is mediated that activates a phosphatidylinositol-calcium second messenger system. Stimulation by BAY u9773, a partial agonist, induces specific contractions of pulmonary veins and might also have an indirect role in the relaxation of the pulmonary vascular endothelium. CysLTR2 is involved in lipid sensing and inflammation. CysLTR2 is associated with diseases such as melanoma, uveal, and adenoid hypertrophy.

Fig.1 Structure of CYSLTR2 membrane protein.

Application of CYSLTR2 Membrane Protein in Literature

Sekioka, T., et al. CysLT₂ receptor activation is involved in LTC₄-induced lung air-trapping in guinea pigs. European journal of pharmacology. 2017, 794:147-153. PubMed ID: 27887950

In this study, it was found that CysLT₂ receptors mediate LTC₄-induced bronchoconstriction and air-trapping in S-hexyl GSH-treated guinea pigs. It is therefore believed that CysLT₂ receptors contribute to asthmatic response involving air-trapping.
Möller, I., et al. Activating cysteinyl leukotriene receptor 2 (CYSLTR2) mutations in blue nevi. Modern Pathology. 2017, 30(3): 350. PubMed ID: 27934878

Authors in this group apply the fragment-based mapping algorithm, FTMap, on the conformations of CYSLTR2 and uncover five non-orthosteric sites on the CYSLTR2.
Jiang, W., et al. Endothelial cysteinyl leukotriene 2 receptor expression mediates myocardial ischemia-reperfusion injury. The American journal of pathology. 2008, 172(3): 592-602. PubMed ID: 18276782

The results of this article reveal that endothelium-targeted overexpression of CysLT2R aggravates myocardial I/R injury by increasing endothelial permeability and exacerbating inflammatory gene expression, leading to accelerated left ventricular remodeling, induction of peri-infarct zone cellular apoptosis, and impaired cardiac performance.
Moore, A. R., et al. Recurrent activating mutations of G-protein-coupled receptor CYSLTR2 in uveal melanoma. Nature genetics. 2016, 48(6): 675-80. PubMed ID: 27089179

The results of this article suggest CYSLTR2 as an oncogene of uveal melanoma and emphasize the critical role of G_αq signaling in uveal melanoma pathogenesis.

CYSLTR2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CYSLTR2 antibody development services.

Through years of accumulation and improvement, Creative Biolabs has successfully produced many functional membrane proteins for our customers. We are pleased to tailor one-stop, custom-oriented service packages regarding a variety of membrane protein targets. For more detail about special membrane protein needs of your projects or research, please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: