DRD1 Membrane Protein Introduction

Introduction of DRD1

DRD1, a subtype of the dopamine receptor, is the most primary dopamine receptor present in the central nervous system. The D1 receptor family is composed of D1 and D5 subtype. DRD1 is a member of G-protein coupled receptor and Gs/a coupled that indirectly activates cyclic AMP-dependent protein kinase, stimulating the neuron. Due to a high degree of structural homology, both DRD1 and another dopamine receptor D5 bind similar drugs.

Basic Information of DRD1
Protein Name	D(1A) dopamine receptor
Gene Name	DRD1
Aliases	DADR, DRD1A
Organism	Homo sapiens (Human)
UniProt ID	P21728
Transmembrane Times	7
Length (aa)	446
Sequence	MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL SVILDYDTDVSLEKIQPITQNGQHPT

Function of DRD1 Membrane Protein

DRD1, an intermediate in the biosynthesis of noradrenaline and adrenaline, mediates the effect of the neurotransmitter dopamine. It is implicated in the control of motor activity and cognitive memory. Downregulation of DRD1 leads to severe impairments in working memory and to locomotor hyperactivity, which are observed in diseases such as schizophrenia, Parkinson's disease, affective disorders, and attention deficit hyperactivity disorder. DRD1 functions as regulation of neuronal growth and development, as well as the mediation of some behavioral responses, and modulation dopamine receptor D2-mediated events. DRD1 is involved in many neurological processes, including motivation, pleasure, cognition as well as modulation of neuroendocrine signaling. Dopaminergic signaling plays an important role in the nervous system and dopamine receptors are expected to be common neurologic drug targets. In addition, they might provide a novel therapeutic target for breast cancer and bone metastasis.

Fig.1 Structure of DRD1 membrane protein.

Application of DRD1 Membrane Protein in Literature

Bétry C., et al. In vivo effects of pardoprunox (SLV308), a partial D₂/D₃ receptor and 5-HT1A receptor agonist, on rat dopamine and serotonin neuronal activity. Synapse, 2011, 65(10): 1042-51. PubMed ID: 21446003

In vivo study has suggested that pardoprunox, a partial D₂/D₃ receptor and 5-HT1A receptor agonist, represents a promising approach for the treatment of Parkinson's disease.
Minami K., et al. Inhibitory Effects of Dopamine Receptor D1 Agonist on Mammary Tumor and Bone Metastasis. Scientific reports. 2017, 7: 45686. PubMed ID: 28374823

This article reveals that dopaminergic signaling might provide a novel therapeutic target for breast cancer and bone metastasis.
Van Kampen J. M., et al. Dopamine D(1A) receptor function in a rodent model of tardive dyskinesia. Neuroscience. 2000, 101(3): 629-35. PubMed ID: 11113312

This article suggests that the dopamine D(1A) receptor is related to the expression of vacuous chewing movements in a rodent model of tardive dyskinesia and may contribute to the pathogenesis of the human disorder.
Snigdha S., et al. Asenapine improves phencyclidine-induced object recognition deficits in the rat: evidence for engagement of a dopamine D1 receptor mechanism. Psychopharmacology. 2011, 214(4): 843-53. PubMed ID: 21088957

This article shows that D(1), but not 5-HT(1A) receptor, play a role in mediating the cognitive effects of asenapine in this rodent model.
Kimura K., et al. Coupling of Human D-1 Dopamine Receptors to Different Guanine Nucleotide Binding Proteins. Evidence That D-1 Dopamine Receptors Can Couple To Both Gs And G. Journal of Biological Chemistry. 1995, 270(24): 14672-8. PubMed ID: 7782330

This article indicates that D-1 dopamine receptors are coupled to both Gs alpha and G(o) alpha but not to Gq alpha.

DRD1 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-DRD1 antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: