DRD4 Membrane Protein Introduction

Introduction of DRD4

DRD4, encoded by the DRD4 gene, is a dopamine D2-like G protein-coupled receptor. A recent report has shown that the structure of DRD4 was in complex with the antipsychotic drug nemonapride. Similar to other dopamine receptor subtypes, the D4 receptor is activated by the neurotransmitter dopamine. Many research have shown that DRD4 was related to many neurological and psychiatric conditions, including schizophrenia and bipolar disorder, attention deficit hyperactivity disorder (ADHD), addictive behaviors, Parkinson's disease, and eating disorders.

Basic Information of DRD4
Protein Name	D(4) dopamine receptor
Gene Name	DRD4
Aliases	NA
Organism	Homo sapiens (Human)
UniProt ID	P21917
Transmembrane Times	7
Length (aa)	467
Sequence	MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPGLPPDPCGPDCAPPAPG LPQDPCGPDCAPPAPGLPRGPCGPDCAPPAPGLPQDPCGPDCAPPAPGLPPDPCGSNCAP PDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWTPFFVVHITQALC PACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC

Function of DRD4 Membrane Protein

Dopamine receptors control neural signals that modulate behavior. The D4 receptor is considered to be D2-like in which the activated receptor inhibits the enzyme adenylate cyclase, thereby reducing the intracellular concentration of the second messenger cyclic AMP. Associations were found with ADHD, substance dependences, several specific personality traits, and reaction to stress. These findings have implications for pharmacogenetics. DRD4 has an influence on the postsynaptic action of dopamine and is implicated in many neurological processes, exhibits polymorphism and is one of the most studied genes in connection with psychiatric disorders. As a target for drugs, DRD4 has been applied, which play a role in treating schizophrenia and Parkinson disease.

Fig.1 Structure of DRD4 membrane protein.

Application of DRD4 Membrane Protein in Literature

Wang S., et al. D₄ dopamine receptor high-resolution structures enable the discovery of selective agonists. Science, 2017. 358: 381-386. PubMed ID: 29051383

This article reports that the selective overexpression of DRD4 at the neuronal level reduced 3-NP-induced neurodegeneration, which suggests an important function of the neuronal DRD4 in the modulation of neurodegeneration.
Yu C., et al. Activation of the D₄ dopamine receptor attenuates proliferation and migration of vascular smooth muscle cells through downregulation of AT_1a receptor expression. Hypertens Res. 2015, 38(9): 588-96. PubMed ID: 25832920

This article reveals that provide insight into the regulatory role of the D(4) receptor on AT(1a) receptor expression and function in VSMCs and suggest that targeting the action of the D(4) receptor may represent an effective therapeutic approach for the treatment of cardiovascular diseases.
Van C. K., et al. Role of dimerization in dopamine D(4) receptor biogenesis. Curr Protein Pept Sci. 2014, 15(7): 659-65. PubMed ID: 25175456

This article shows that the dopamine D(4) receptor is an interesting receptor since it has a polymorphic region in its third intracellular loop, resulting in receptor isoforms of varying length and amino acid composition.
Radek P., et al. Dopamine D4 receptor gene DRD4 and its association with psychiatric disorders. Med Sci Monit. 2011, 17(9): RA215-RA220. PubMed ID: 21873960

This article reviews the principle published associations of DRD4 variants with psychiatric disorders.

DRD4 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-DRD4 antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: