F2RL1 Membrane Protein Introduction

Introduction of F2RL1

F2RL1, also referred as PAR2 (protease activated receptor 2) or GPR11 (G-protein coupled receptor 11), is a protein product as a member of the G-protein coupled receptor family, as well as the protease-activated receptor family, encoded by the F2RL1 gene. It is noteworthy that the protein can be activated by trypsin, but not by thrombin. It has been demonstrated that activation of the receptor is associated with stimulation of vascular smooth muscle relaxation, dilation of blood vessels, increase of blood flow, and a lowering of blood pressure. In addition, this protein plays an important role in both inflammatory response and innate and adaptive immunity.

Basic Information ofF2RL1
Protein Name	Proteinase-activated receptor 2
Gene Name	F2RL1
Aliases	PAR2, GPR11
Organism	Homo sapiens (Human)
UniProt ID	P55085
Transmembrane Times	7
Length (aa)	397
Sequence	MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFS VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY

Function of F2RL1 Membrane Protein

PAR2 is activated by proteolytic cleavage of its extracellular amino terminus. Activation of the receptor contributes to stimulating vascular smooth muscle relaxation, dilate blood vessels, increase blood flow, and lower blood pressure. PAR2 takes part in the recruitment of leukocytes to the sites of inflammation and serves as the major PAR receptor. Additionally, these receptors can be activated by exogenous proteases, such as house dust mite protein Der P9.

F2RL1 Membrane Protein Introduction

Application of F2RL1 Membrane Protein in Literature

Hara T., et al. Protease-Activated Receptor-2 Plays a Critical Role in Vascular Inflammation and Atherosclerosis in Apolipoprotein E-Deficient Mice. Circulation. 2018. PubMed ID: 29700120

This article reveals that PAR-2 signaling activates macrophages and promotes vascular inflammation, increasing atherosclerosis in ApoE^-/- mice. This signaling pathway may also participate in atherogenesis in humans.
Lü Q., et al. Research progress on protease-activated receptor 2 in pathogenesis of osteoarthritis. Zhongguo Xiu Fu Chong Jian Wai Ke Za Zhi. 2017, 31(12): 1517-1522. PubMed ID: 29806398

This article shows that PAR-2 has been involved in the pathogenesis of osteoarthritis (OA).
Sun L., et al. Proteinase-activated receptor 2 promotes tumor cell proliferation and metastasis by inducing epithelial-mesenchymal transition and predicts poor prognosis in hepatocellular carcinoma. World J Gastroenterol. 2018, 24(10): 1120-1133. PubMed ID: 29563756

This article suggests that PAR2 plays an important role in the proliferation and metastasis of hepatocellular carcinoma. Therefore, targeting PAR2 may present a favorable target for treatment of this malignancy.
Lee K H., et al. Cigarette smoke extract enhances neutrophil elastase-induced IL-8 production via proteinase-activated receptor-2 upregulation in human bronchial epithelial cells. Exp Mol Med. 2018, 50(7): 79. PubMed ID: 29980681

This article suggests that cigarette smoke extract (CSE) upregulates PAR2 in normal human bronchial epithelial cells, thereby enhancing the inflammatory response to NE.

F2RL1 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-F2RL1 antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: