Introduction of FXYD6
FXYD domain containing ion transport regulator 6 (FXYD6), also known as phosphohippolin, is a protein encoded by the human FXYD6 gene. It is the sixth defined member of the FXYD family of ion transport regulators, whose members are named due to the presence of a highly conserved FXYD motif in their amino acid sequences. Studies have suggested that the FXYD6 protein contains 95 amino acids, and can be found in all human tissues except blood.
Basic Information of FXYD6 | |
Protein Name | FXYD domain-containing ion transport regulator 6 |
Gene Name | FXYD6 |
Aliases | Phosphohippolin |
Organism | Homo sapiens (Human) |
UniProt ID | Q9H0Q3 |
Transmembrane Times | 1 |
Length (aa) | 112 |
Sequence | MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILRPQEMRKPRWRTSSPPMQQSPRKQRTEVQPSGGRRQPQGGRGPVLLWQKIPLWGQ |
Function of FXYD6 Membrane Protein
FXYD6 (phosphohippolin) is a member of the FXYD protein family that is involved in modulating the kinetic properties of the Na+, K+-ATPase in a tissue-specific fashion. It is expressed in diverse tissues, particularly in the cochlea, the brain and to a lesser extent, in the lung, testis, and colon. Studies have shown that this protein is located mainly in the marginal cells and in the intermediate cells of the stria vascularis. It could colocalize with the Na+, K+-ATPase in the stria vascularis, and its association with 12 isozymes increases their apparent K+ and Na+ affinity. These results suggest that FXYD6 plays an important role in endolymph production in the cochlea. Furthermore, FXYD6 also plays an essential role in the excitability and development of neurons.
Fig.1 Structural characteristics of FXYD proteins. (Geering, 2006)
Application FXYD6 of Membrane Protein in Literature
This article suggests that FXYD6 is up-regulated in hepatocellular carcinoma (HCC) and enhances the migration and proliferation of HCC cells. It indicates that FXYD6 play a critical role in HCC progression and the therapy targeting FXYD6 can benefit the clinical treatment toward HCC patients.
This article indicates that FXYD6 may be a new biomarker for cholangiocarcinoma and may be associated with a favorable prognosis in this malignant disease.
This article shows that FXYD6 is predominantly expressed in the intermediate portion of the endolymphatic sac, and it is colocalized with the Na(+), K(+)-ATPase, which indicates that an interaction of FXYD6 with this transporter may be critically involved in the regulation of the characteristics of the endolymph.
This article aims to investigate the association between the single nucleotide polymorphisms (SNPs) in the FXYD6 gene and schizophrenia in a family-trios population. It indicates that the FXYD6 gene might play an important role in schizophrenia susceptibility.
This report aims to study the potential role of FXYD6 in inner ear function. It indicates that there exists functional cooperation between FXYD6 and Na, K-ATPase in the generation and maintenance of the endocochlear potential and ion composition of the endolymph.
FXYD6 Preparation Options
To provide high-quality membrane protein products, we have developed advanced Magic™ membrane protein production platform which enables us to provide high-quality membrane protein products. Besides, aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FXYD6 antibody development services.
With the help of professional scientists, Creative Biolabs is dedicated to offering multiple membrane protein preparation services for global customers. In addition to FXYD6 membrane protein products, we also provide other membrane protein preparation services to meet every client’s specific requirements. To learn more detailed information, please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.