FXYD6 Membrane Protein Introduction

Introduction of FXYD6

FXYD domain containing ion transport regulator 6 (FXYD6), also known as phosphohippolin, is a protein encoded by the human FXYD6 gene. It is the sixth defined member of the FXYD family of ion transport regulators, whose members are named due to the presence of a highly conserved FXYD motif in their amino acid sequences. Studies have suggested that the FXYD6 protein contains 95 amino acids, and can be found in all human tissues except blood.

Basic Information of FXYD6
Protein Name	FXYD domain-containing ion transport regulator 6
Gene Name	FXYD6
Aliases	Phosphohippolin
Organism	Homo sapiens (Human)
UniProt ID	Q9H0Q3
Transmembrane Times	1
Length (aa)	112
Sequence	MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILRPQEMRKPRWRTSSPPMQQSPRKQRTEVQPSGGRRQPQGGRGPVLLWQKIPLWGQ

Function of FXYD6 Membrane Protein

FXYD6 (phosphohippolin) is a member of the FXYD protein family that is involved in modulating the kinetic properties of the Na⁺, K⁺-ATPase in a tissue-specific fashion. It is expressed in diverse tissues, particularly in the cochlea, the brain and to a lesser extent, in the lung, testis, and colon. Studies have shown that this protein is located mainly in the marginal cells and in the intermediate cells of the stria vascularis. It could colocalize with the Na⁺, K⁺-ATPase in the stria vascularis, and its association with 12 isozymes increases their apparent K⁺ and Na⁺ affinity. These results suggest that FXYD6 plays an important role in endolymph production in the cochlea. Furthermore, FXYD6 also plays an essential role in the excitability and development of neurons.

FXYD6 Membrane Protein Introduction Fig.1 Structural characteristics of FXYD proteins. (Geering, 2006)

Application FXYD6 of Membrane Protein in Literature

Gao Q., et al. FXYD6: a novel therapeutic target toward hepatocellular carcinoma. Protein & Cell. 2014, 5(7):532-43. PubMed ID: 24715268

This article suggests that FXYD6 is up-regulated in hepatocellular carcinoma (HCC) and enhances the migration and proliferation of HCC cells. It indicates that FXYD6 play a critical role in HCC progression and the therapy targeting FXYD6 can benefit the clinical treatment toward HCC patients.
Chen X., et al. FXYD6 is a new biomarker of cholangiocarcinoma. Oncology Letters. 2014, 7(2):393-8. PubMed ID: 24396454

This article indicates that FXYD6 may be a new biomarker for cholangiocarcinoma and may be associated with a favorable prognosis in this malignant disease.
Miyashita T., et al. Presence of FXYD6 in the endolymphatic sac epithelia. Neuroscience Letters. 2012, 513(1):47-50. PubMed ID: 22343024

This article shows that FXYD6 is predominantly expressed in the intermediate portion of the endolymphatic sac, and it is colocalized with the Na(+), K(+)-ATPase, which indicates that an interaction of FXYD6 with this transporter may be critically involved in the regulation of the characteristics of the endolymph.
Jiao L.Z., et al. A family-based association study of FXYD6 gene polymorphisms and schizophrenia. Chinese Journal of Medical Genetics. 2011, 28(5):539-42. PubMed ID: 21983730

This article aims to investigate the association between the single nucleotide polymorphisms (SNPs) in the FXYD6 gene and schizophrenia in a family-trios population. It indicates that the FXYD6 gene might play an important role in schizophrenia susceptibility.
Delprat B., et al. Dynamic expression of FXYD6 in the inner ear suggests a role of the protein in endolymph homeostasis and neuronal activity. Developmental Dynamics. 2007, 236(9):2534-40. PubMed ID: 17676640

This report aims to study the potential role of FXYD6 in inner ear function. It indicates that there exists functional cooperation between FXYD6 and Na, K-ATPase in the generation and maintenance of the endocochlear potential and ion composition of the endolymph.

FXYD6 Preparation Options

To provide high-quality membrane protein products, we have developed advanced Magic™ membrane protein production platform which enables us to provide high-quality membrane protein products. Besides, aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FXYD6 antibody development services.

With the help of professional scientists, Creative Biolabs is dedicated to offering multiple membrane protein preparation services for global customers. In addition to FXYD6 membrane protein products, we also provide other membrane protein preparation services to meet every client’s specific requirements. To learn more detailed information, please feel free to contact us for more information.

Reference

Geering K. (2006). FXYD proteins: new regulators of Na-K-ATPase. American Journal of Physiology-Renal Physiology. 290(2), F241-F250.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: