FZD4 Membrane Protein Introduction

Introduction of FZD4

FZD4 is encoded by the FZD4 gene which belongs to the G-protein-coupled receptor (GPCR) family. In the past few decades, the GPCR family has been largely studied because of its numerous possibilities for therapeutic applications. It is one of the ten subtypes of the frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10). Among all FZD subtypes, FZD4 spans a total of 7392 nucleotides and encodes the protein with 537 amino acids. This protein contains seven transmembrane domains and the N-terminal cysteine-rich domain.

Basic Information of FZD4
Protein Name	Frizzled-4
Gene Name	FZD4
Aliases	Fz4, EVR1, FEVR, Fz-4, FzE4, GPCR, hFz4, CD344, FZD4S
Organism	Homo sapiens (Human)
UniProt ID	Q9ULV1
Transmembrane Times	7
Length (aa)	537
Sequence	MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHE LQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWP ESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGL YSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERI SCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIA AWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGIT SGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV

Function of FZD4 Membrane Protein

Frizzled family, encoded by the Frizzled genes, is implicated in a series of cellular processes including cell polarity control, cell fate determination, and malignant transformation. As the only representative of frizzled family members, it presents similar binding function but different construction with wingless type proteins. The FZD4 plays an important role in the wingless type MMTV integration site signaling pathway as a positive regulator. The FZD4 mRNA have been detected in various human tissues especial in fetal kidney, skeletal muscle, adult heart, and ovary. Moreover, FZD4 is homologous to FZD9 and FZD10. It has been reported that mutant FZD4 associated with exudative vitreoretinopathy by disrupting retinal angiogenesis. Among its related pathways are ectoderm differentiation and mesodermal commitment pathway.

Fig.1 Structure of FZD4 membrane protein.

Application of FZD4 Membrane Protein in Literature

YangY., et al. Down regulation of miR-3127-5p promotes epithelial-mesenchymal transition via FZD4 regulation of Wnt/β-catenin signaling in non-small-cell lung cancer. Molecular Carcinogenesis. 2018. PubMed ID: 29770921

This article reports that the expression levels of miR-3127-5p and FZD4 are negatively associated with tumors and the down regulation of miR-3127-5p can promote EMT so that presents potential to be a therapeutic target for NSCLC metastasis.
Ma C., et al. MicroRNA-505 predicts prognosis and acts as tumor inhibitor in cervical carcinoma with inverse association with FZD4. Biomedicine & pharmacotherapy. 2017, 92: 586-594. PubMed ID: 29770921

This article reveals that the expression of MiR-505 in cervical cancer cells is low and has been served as the potential cancer inhibitor and prognostic factor. FZD4 presents dramatic regulatory function in cervical cancer.
Khan A.O., et al. A family harboring homozygous FZD4 deletion supports the existence of recessive FZD4-related familial exudative vitreoretinopathy. Ophthalmic Genetics. 2016, 38(4): 380-382. PubMed ID: 29770921

This article reports that the mutation of FZD4 alleles might be associated with recessive rather than a dominant disease in some case.
SeoS.H., et al. Molecular Characterization of FZD4, LRP5, and TSPAN12 in Familial Exudative Vitreoretinopathy. Investigative Ophthalmology & Visual Science. 2015, 56(9): 5143-5151. PubMed ID: 29770921

Authors in this group focus on the familial exudative vitreoretinopathy (FEVR) which is a rare hereditary disorder with the characterization of failed peripheral retinal vascularization. The mutation of FZD4, LRP5, and TSPAN12 are associated with the autosomal inheritance form of FEVR.
HiroyukiS., et al. Genetic variants of FZD4 and LRP5 genes in patients with advanced retinopathy of prematurity. Molecular Vision. 2013, 19: 476. PubMed ID: 29770921

This article focuses on the retinopathy of prematurity (ROP) which is a complex disease with a genetic predisposition. The author has found six possible mutations of FZD4 or LRP5 in advanced ROP patients.

FZD4 Preparation Options

In order to get the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD4 antibody development services.

Based on our extensive experience and advanced platforms, Creative Biolabs is always dedicated to assisting our clients with the most satisfactory membrane protein antibody related services. If you are interested in our service, please do not hesitate to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: