FZD5 Membrane Protein Introduction

Introduction of FZD5

FZD5 is a 7-transmembrane receptor belonging to the frizzled family. Encoded by the FZD5 gene in human, it is one of the ten subtypes of the frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10). FZD5 belongs to the G-protein-coupled receptor (GPCR) family which has been studied well in recent years because of its great potential for therapeutic applications. The FZD5 protein has been served as the receptor for the WNT5A ligand and plays an important role in angiogenesis.

Basic Information of FZD5
Protein Name	Frizzled-5
Gene Name	FZD5
Aliases	HFZ5, C2orf31
Organism	Homo sapiens (Human)
UniProt ID	Q13467
Transmembrane Times	7
Length (aa)	585
Sequence	MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQF WPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLG RDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKV RTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLC VSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGN EAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHD TGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRPRRGHKSGGAMAAGDYPEAS AALTGRTGPPGPAATYHKQVSLSHV

Function of FZD5 Membrane Protein

Frizzled family plays key roles in cell proliferation, governing cell polarity, the formation of neural synapses, embryonic development, and some other processes in developing and adult organisms. It has been reported that monocyte-secreted WNT5A interacts with FZD5 in microvascular endothelial cells and induces angiogenesis through tissue factor signaling. Its related pathways contain ectoderm differentiation and mesodermal commitment pathway. It has been also reported that the Wnt-Frizzled signaling presents the conserved role in ocular development. In addition, the diseases associated with FZD5 include coloboma of optic nerve and coloboma of the eyelid.

Fig .1 Structure of FZD5.

Application of FZD5 Membrane Protein in Literature

Zhu Q., et al. CircRNA circ_0067934 promotes tumor growth and metastasis in hepatocellular carcinoma through regulation of miR-1324/FZD5/Wnt/β-catenin axis. Biochem Biophys Res Commun. 2018, 497(2): 626-632. PubMed ID: 29458020

Recently, it has been proved that circular RNAs plays an important role in the progression of human cancers. This article reports that circ_0067934 enables the proliferation, migration, and invasion of HCC cells via the miR-1324c inhibition and FZD5/Wnt/b-catenin signaling pathway. In summary, this signaling axis might be served as the potential therapeutic target for HCC intervention.
Maarten M.B., et al. Endothelial loss of Fzd5 stimulates PKC/Ets1-mediated transcription of Angpt2 and Flt1. Angiogenesis. 2018, 1-17. PubMed ID: 29845518

This article reveals that the pro-angiogenic role of FZD5 is accomplished by the endothelial tubule formation, cell cycle progression, and migration, and the repression of PKC/Ets1-mediated transcription of Flt1 and Angpt2.
Dai Y., et al. MicroRNA-216b actively modulates diabetic angiopathy through inverse regulation on FZD5. Gene. 2018, 658: 129-135. PubMed ID: 29477872

Authors in this group reveal that the down regulation of microRNA-216b in diabetic MMECs enhances the angiogenesis in diabetic angiopathy via the inverse regulation on FZD5.
Liu C., et al. A secreted WNT-ligand-binding domain of FZD5 generated by a frameshift mutation causes autosomal dominant coloboma. Human Molecular Genetics. 2016, 25(7): 1382-1391. PubMed ID: 26908622

Ocular coloboma is the common eye malformation caused by the incomplete fusion of the optic fissure during development. This article revealed the conserved role of Wnt-Frizzled signaling in ocular development.
Chen M., et al. Wnt5a/FZD5/CaMKII signaling pathway mediates the effect of BML-111 on inflammatory reactions in sepsis. International Journal of Clinical & Experimental Medicine. 2015, 8(10): 17824. PubMed ID: 26770375

This article first demonstrated that BML-111 suppresses the Wnt5a/FZD5/CaMKII signaling pathway in sepsis which mediates the inflammatory reactions. In summary, BML-111 presents potential functions in sepsis.

FZD5 Preparation Options

In order to obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD5 antibody development services.

Based on our extensive experience and advanced platforms, Creative Biolabs has the capability to enable you to free up your time for membrane protein preparation. If you are interested in our services, please do not hesitate to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: