FZD6 Membrane Protein Introduction

Introduction of FZD6

FZD6 is encoded by the FZD6 gene. It belongs to the G-protein-coupled receptor (GPCR) family which shows numerous possibilities for therapeutic applications in recent decades. FZD6 is one of the ten subtypes of the Frizzled family (FZD1, FZD2, FZD3, FZD4, FZD5, FZD6, FZD7, FZD8, FZD9, FZD10) with 706 amino acids. Different from other family members, FZD6 does not contain the C-terminal PDZ domain-binding motif.

Basic Information of FZD6
Protein Name	Frizzled-6
Gene Name	FZD6
Aliases	FZ6, FZ-6, HFZ6, NDNC10
Organism	Homo sapiens (Human)
UniProt ID	O60353
Transmembrane Times	7
Length (aa)	706
Sequence	MEMFTFLLTCIFLPLLRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEHFLPLANLECS PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPH TEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQCAPPCPNMYFKSDELEFAKSFIGTVSIFCL CATLFTFLTFLIDVRRFRYPERPIIYYSVCYSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNK ACTVLFMLLYFFTMAGTVWWVILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEG DNISGVCFVGLYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMIKYLMTLIVGISA VFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHKKKHYKPSSHKLKVISKSMGT STGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSG EQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGG GCHSDT

Function of FZD6 Membrane Protein

FZD6 belongs to the Frizzled family whose members have been served as receptors for Wnt signaling proteins. In general, the frizzled receptors can be coupled to the β-catenin canonical signaling pathway and finally leads to various applications, such as inhibition of GSK-3 kinase, activation of Wnt target genes, activation of disheveled proteins, and nuclear accumulation of β-catenin. The FZD6 is over-expressed in the keratogenous zone of the ventral matrix. FZD6 has been shown to act as the positive regulator for the noncanonical WNT or planar cell polarity pathway and the negative regulator for the canonical WNT/β-catenin signaling cascade. The diseases related to FZD6 include nail disorder and nail disease. It has been reported that FZD6 mutation has been identified in isolated nail dysplasia.

Fig.1 Structure of FZD6.

Application of FZD6 Membrane Protein in Literature

Chen Z., et al. LncFZD6 initiates Wnt/β-catenin and liver TIC self-renewal through BRG1-mediated FZD6 transcriptional activation . Oncogene. 2018, 37(23): 3098. PubMed ID: 29535420

Liver tumor-initiating cells (TICs) are the drivers for liver tumorigenesis. This article reports that IncFZD6 enables the promotion of Wnt/β-catenin activation and self-renewal of liver TIC via BRG1-dependent FZD6 expression.
Corda G., et al. Functional and prognostic significance of the genomic amplification of frizzled receptor 6 (FZD6) in breast cancer. The Journal of Pathology. 2017, 241(3): 350-361. PubMed ID: 27859262

This article reports that FZD6 is frequently amplified in breast cancer and increase the incidence of the triple negative breast cancer subtype. The FZD6-fibronectin-actin axis might be used for the drug development of breast cancer.
Corda G., et al. Non-canonical WNT/PCP signaling in cancer: Fzd6 takes centre stage. Oncogenesis. 2017, 6(7): e364. PubMed ID: 28737757

This article reveals that the FZD6-regulated Wnt non-canonical pathway plays an important role in the pathogenesis of various human malignancies. The research of FZD6 might result in the identification of new targets for cancer treatment.
Mohammadi-Asl J., et al. A novel pathogenic variant in the FZD6 gene causes recessive nail dysplasia in a large Iranian kindred. Journal of Dermatological Science. 2017, 88(1): 134-138. PubMed ID: 28545862

This article reveals that the research of FZD6 might be the first step for the diagnostic of autosomal recessive NDNC patients with enlarged nails.
Huang T., et al. A regulatory circuit of miR-125b/miR-20b and Wnt signalling controls glioblastoma phenotypes through FZD6-modulated pathways. Nature Communications. 2016, 7: 12885. PubMed ID: 27698350

This article reports that FZD6 works as the negative regulator of TCF4-miR-125b/miR-20b-FZD6 via the activation of CaMKII-TAK1-NLK signaling. The components of this circuit relate to the prognostic of clinical glioblastoma (GBM). This article provides insights into GBM pathogenesis understanding and treatment.

FZD6 Preparation Options

In order to harvest the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-FZD6 antibody development services.

As a pioneer and the undisputed global leader in the field of membrane protein preparation, Creative Biolabs offers the most comprehensive membrane protein services. Our various strategies can be tailor-designed to meet your specific needs. If you are interested in our services, please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: