Introduction of GABBR1
GABBR1 is encoded by the GABBR1 gene. The GABBR1 gene is located in humans at 6p21.3. It contains 22 exons and its mRNA is 4.4 kb in length. It is a G-protein coupled receptor subunit, inhibition of adenylyl cyclase activity, stimulation of phospholipase A2, activation of potassium channels, inactivation of voltage-dependent calcium channels, and modulation of inositol phospholipid hydrolysis of G-proteins mediate their activity. GABBR1 plays a key role in the fine-tuning of inhibitory synaptic transmission.
Basic Information of GABBR1 | |
Protein Name | Gamma-aminobutyric acid type B receptor subunit 1 |
Gene Name | GABBR1 |
Aliases | GABABR1, GABBR1-3, GB1, GPRC3A, dJ271M21.1.1, dJ271M21.1.2 |
Organism | Homo sapiens (Human) |
UniProt ID | Q9UBS5 |
Transmembrane Times | 7 |
Length (aa) | 961 |
Sequence |
MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIE YVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVD FRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAV EMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEA ARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFT STLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLF GKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVE KLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRA MNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPAD QTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLA LAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNT WLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDA AFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENR ELEKIIAEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK |
Function of GABBR1 Membrane Protein
The GABA heterodimeric G protein-coupled receptors formed by GABBR1 and GABBR2 are within the heterodimeric GABA receptor, GABBR1 binding agonists, and GABBR2 mediates the coupling of G proteins. When the ligand binds to it, it causes a conformational change, and the regulation of the activity of the downstream effector is accomplished by triggering signal transduction by a guanine nucleotide binding protein (G protein), which eventually inhibits adenylyl cyclase, stimulating phospholipase A2, which activates potassium channels, inactivates voltage-dependent calcium channels and regulates the hydrolysis of inositol phospholipids. Presynaptic GABA receptors down-regulate high voltage-activated calcium channels to inhibit neurotransmitter release. Moreover, postsynaptic GABA receptors reduce neuronal excitability by activating prominent inward rectifier potassium (Kir) conductance as late inhibitory synapses post-potential basis.
Fig.1 Structure of GABA receptors subunit composition. (Eduardo, 2012)
Application of GABBR1 Membrane Protein in Literature
The article shows that with both GABBR1 and SLC6A1, the minor genotypes/alleles are protective against risk for alcoholism. Finally, GABBR1 rs29220 might predict treatment response/adverse effects for baclofen, a GABAB receptor agonist.
This article reveals that pregnancy anxiety is associated with differential DNA methylation patterns in newborns and that candidate gene GABBR1 is associated with infant hypothalamic-pituitary-adrenal axis response to a stressor. The findings reveal a potential role for GABBR1 methylation in association with stress and provide grounds for further research.
The article demonstrates that miR-106a/b, miR-20a/b and miR-17 promote the proliferation and invasion of colorectal cancer by targeting their common target gene GABBR1, and play a key role in the proliferation and invasion of colorectal cancer.
This article indicates that there is an ANG II/AT1R/HoxD10/miR-7b/GABBR1 pathway in the PVN that contributes to sympathoexcitation and deterioration of cardiac function in CHF.
This article shows that GABBR1 is of central importance to schizophrenia, even if there was no direct causal relationship at that time. In addition to being the center of microRNA-derived regulatory pathways and protein-protein interactions, its centrality is also supported by a large number of cis-regulatory elements and transcription factor binding sites that regulate its transcription.
GABBR1 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GABBR1 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.