GLP2R Membrane Protein Introduction

Introduction of GLP2R

The glucagon-like peptide 2 receptor (GLP2R) is a receptor protein encoded by the gene GLP2R. The G protein activates adenylate cyclase to mediate the activity of the GLP2R receptor. GLP2 signaling can stimulate intestinal growth and increase the villus height in the small intestine, accompanied by an increase in crypt cell proliferation and a decrease in intestinal cell apoptosis.

Basic Information of GLP2R
Protein Name	Glucagon-like peptide 2 receptor
Gene Name	GLP2R
Aliases	GLP-2-R
Organism	Homo sapiens (Human)
UniProt ID	O95838
Transmembrane Times	7
Length (aa)	553
Sequence	MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVS IKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPS YLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSENHSFKQNVDRYALLSTLQL MYTVGYSFSLISLFLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYS KRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLW PRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLK ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI QLTLSSFHGFLVALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKK LSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTM ANTMEEILEESEI

Function of GLP2R Membrane Protein

GLP2R is a receptor for glucagon-like peptide 2. Glucagon-like peptide-2 (GLP-2) is a 33 amino acid glucagon-derived peptide produced by enteroendocrine cells that can act as a growth factor to enlarge the surface area of mucosal epithelium. GLP2 binds to GLP2R to stimulate intestinal growth and up-regulate the villus height in the small intestine, accompanied by an increase in crypt cell proliferation and a decrease in intestinal cell apoptosis. In addition, GLP2 prevents intestinal hypoplasia caused by total parenteral nutrition.

Fig.1 Structure of GLP2R.

Application of GLP2R Membrane Protein in Literature

Lee S.J., et al. Disruption of the Murine Glp2r Impairs Paneth Cell Function and Increases Susceptibility to Small Bowel Enteritis. Endocrinology. 2012, 153(3): 1141–1151. PubMed ID: 22253424

This research reports an important role in preventing intestinal mucosal damage and maintaining basal GLP-2R activity in normal host-bacterial interactions in the gastrointestinal tract.
Guan X., et al. GLP-2 receptor in POMC neurons suppresses feeding behavior and gastric motility. Am J Physiol Endocrinol Metab. 2012, 303(7): E853–E864. PubMed ID: 22829581

This paper reveals that the central nervous system (CNS) GLP-2R plays an important physiological role in controlling food intake and gastric emptying. The melanocortin system mediates POMC neurons regulating CNS food intake and gastric emptying.
Lee J., et al. Enteroendocrine-derived glucagon-like peptide-2 controls intestinal amino acid transport. Mol Metab. 2017, 6(3): 245–255. PubMed ID: 28271031

This article reveals that GLP-2R signaling plays an important role in the physiological and pharmacological control of amino acid perception and assimilation in the intestine.
Koehler J.A., et al. Glucagon-like Peptide-2 Does Not Modify the Growth or Survival of Murine or Human Intestinal Tumor Cells. Cancer Res. 2008, 68(19): 7897–7904.PubMed ID: 18829546

This article suggests that GLP-2R activation contributes to the signaling pathways that promote normal intestinal epithelial cell proliferation and cytoprotection, but that sustained regulation of GLP-2R signaling does not alter the growth or survival of intestinal tumor cells.
Shi X., et al. Central GLP-2 enhances hepatic insulin sensitivity via activating PI3K signaling in POMC neurons. Cell Metab. 2013, 18(1): 86–98. PubMed ID: 23823479

Glucose intolerance and hepatic insulin resistance in mouse POMC neurons of the GLP-2 receptor (GLP-2R) are evaluated in this paper. GLP-2R activation is required for GLP-2 to enhance insulin-mediated inhibition of hepatic glucose production (HGP) and gluconeogenesis.

GLP2R Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GLP2R antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: