GNRHR Membrane Protein Introduction

Introduction of GNRHR

The gonadotropin-releasing hormone receptor (GNRHR) is a receptor protein encoded by gene GNRHR. This receptor is a member of the G-protein coupled receptor (GPCR) family and expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary and prostate. It can promote the release of a gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH) by binding with GNRHR.

Basic Information of GNRHR
Protein Name	Gonadotropin-releasing hormone receptor
Gene Name	GNRHR
Aliases	GnRH-R, GRHR, LHRHR, LRHR
Organism	Homo sapiens (Human)
UniProt ID	P30968
Transmembrane Times	7
Length (aa)	328
Sequence	MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL SDPVNHFFFLFAFLNPCFDPLIYGYFSL

Function of GNRHR Membrane Protein

GNRHR is a receptor for the gonadotropin-releasing hormone. It is the central point of the hypothalamus secretion produced and secreted by the combination of hypothalamic GnRH and pituitary gonadotropin in mammals. The combination of GNRHR and GnRH results in the dissociation of receptor-related heterogeneous dimer G protein and the initiation of several intracellular signaling cascades and causes extracellular and intracellular calcium fluxes, several MAPK pathways of activation, including those that lead to ERK1 activation and C-jun N-terminal kinase (JNK) pathways.

GNRHR Membrane Protein Introduction

Application of GNRHR Membrane Protein in Literature

Schauer C., et al. Hypothalamic gonadotropin-releasing hormone (GnRH) receptor neurons fire in synchrony with the female reproductive cycle. J Neurophysiol. 2015, 114(2): 1008–1021. PubMed ID: 26063780

This article reports that endogenous GnRH acts on GnRHR neurons and triggers burst to fire in these cells during late proestrus and estrus.
Busby E.R., et al. Gonadotropin-releasing hormone receptor (Gnrhr) gene knock out: Normal growth and development of sensory, motor and spatial orientation behavior but altered metabolism in neonatal and prepubertal mice. PLoS One. 2017. PubMed ID: 28346489

The article demonstrates that the GnRH-GnRHR system is not required for growth or exercise/sensory/directional behavior for the first month prior to the onset of puberty. However, the lack of the GnRH-GnRHR axis results in a decrease in the weight of the female subcutaneous inguinal fat pad and an increase in glucose and may result in insulin resistance.
Avet C., et al. SET Protein Interacts with Intracellular Domains of the Gonadotropin-releasing Hormone Receptor and Differentially Regulates Receptor Signaling to cAMP and Calcium in Gonadotrope Cells. J Biol Chem. 2013, 288(4): 2641–2654. PubMed ID: 23233674

The article demonstrates that the first direct interaction partner of GnRHR is SET, which is helpful for the conversion of GnRHR signaling to the cAMP pathway.
Lu M.Z., et al. The lower expression of gonadotropin-releasing hormone receptor associated with poor prognosis in gastric cancer. Int J Clin Exp Med. 2015, 8(8): 13365–13370. PubMed ID: 26550267

This article shows that the GnRHR expression is very low in gastric cancer, and the loss of GnRHR expression could be a poor prognostic factor, which implied that GnRHR could play an important role in the development of gastric cancer.
Nakamura Y., et al. Aberrant gonadotropin-releasing hormone receptor (GnRHR) expression and its regulation of CYP11B2 expression and aldosterone production in adrenal aldosterone-producing adenoma (APA). Mol Cell Endocrinol. 2014, 384(0): 102–108. PubMed ID: 24472523

This article assesses the aberrant expression of the gonadotropin-releasing hormone receptor (GnRHR) in human adrenal tissue, including aldosterone-producing adenomas (APA). And the ectopic expression of GnRH through its receptor may be a potential regulator of CYP11B2 expression levels in certain APA cases.

GNRHR Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GNRHR antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: