GPR149 Membrane Protein Introduction

Introduction of GPR149

GPR149 is encoded by the GPR149 gene which is located at 3q25.2. The mass of GPR149 is 80,984 Da. GPR149 belongs to the G-protein-coupled receptor (GPCR) family of which all members have seven-transmembrane domains and can be widely divided into two groups, the chemosensory GPCRs that respond to external sensory signals such as odors, pheromones, and tastes, and the endoGPCRs that respond to endogenous signals, including peptides, hormones, lipids, neurotransmitters, and nucleotides. Besides, phylogenetic analysis of GPR149 from fish to mammals suggests that it is widely conserved in vertebrates.

Basic Information of GPR149
Protein Name	Probable G-protein coupled receptor 149
Gene Name	GPR149
Aliases	G-protein coupled receptor PGR10
Organism	Homo sapiens (Human)
UniProt ID	Q86SP6
Transmembrane Times	7
Length (aa)	731
Sequence	MSLFLSNLSTNDSSLWKENHNSTDLLNPPGTLNIYLFCLTCLMTFAALVGSIYSLISLLKMQNRTVVSMLVASWSVDDLMSVLSVTIFMFLQWPNEVPGYFQFLCTTSALMYLCQGLSSNLKATLLVSYNFYTMHRGVGSQTASRRSGQVLGVVLTVWAASLLLSALPLCGWGAFVRTPWGCLVDCSSSYVLFLSIVYALAFGLLVGLSVPLTHRLLCSEEPPRLHSNYQEISRGASIPGTPPTAGRVVSLSPEDAPGPSLRRSGGCSPSSDTVFGPGAPAAAGAEACRRENRGTLYGTRSFTVSVAQKRFALILALTKVVLWLPMMMHMVVQNVVGFQSLPLETFSFLLTLLATTVTPVFVLSKRWTHLPCGCIINCRQNAYAVASDGKKIKRKGFEFNLSFQKSYGIYKIAHEDYYDDDENSIFYHNLMNSECETTKDPQRDNRNIFNAIKVEISTTPSLDSSTQRGINKCTNTDITEAKQDSNNKKDAFSDKTGGDINYEETTFSEGPERRLSHEESQKPDLSDWEWCRSKSERTPRQRSGYALAIPLCAFQGTVSLHAPTGKTLSLSTYEVSAEGQKITPASKKIEVYRSKSVGHEPNSEDSSSTFVDTSVKIHLEVLEICDNEEALDTVSIISNISQSSTQVRSPSLRYSRKENRFVSCDLGETASYSLFLPTSNPDGDINISIPDTVEAHRQNSKRQHQERDGYQEEIQLLNKAYRKREEESKGS

Function of GPR149 Membrane Protein

GPR149 is an orphan G-protein coupled receptor whose molecular function including G-protein coupled receptor activity and neuropeptide binding. GPR149 also plays a very important role in many biological processes, such as antral ovarian follicle growth, chemical synaptic transmission, G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger, negative regulation of ovulation, neuropeptide signaling pathway and preantral ovarian follicle growth. It has been proved that GPR149 is highly expressed in the ovary and in the brain and the digestive tract at low levels, and deletion of it leads to increased fertility in mice. GPR149 levels are low in newborn ovaries but they increase throughout folliculogenesis GPR149 null mice are one of the few models with enhanced fertility. Beyond that, GPR149 takes part in the prostatic cancerogenesis, it may be a potential marker of prostatic cancer.

Fig.1 Light-activated human orphan and understudied GPCRs (Morri, 2018)

Application of GPR149 Membrane Protein in Literature

John A.A., et al. Genome-wide tissue transcriptome profiling and ligand screening identify seven striatum-specific human orphan GPCRs. The FASEB Journal. 2017, 31(1), 576.

This article suggests the seven identified human orphan GPCRs including GPR149, are potential drug targets amenable to screening whose pharmacological modulation may be therapeutic for treating striatum-related neurological diseases.
Vozianov S.O., et al. Identification of a new diagnostic markers of prostatic cancer, using noti-microchips. Klin Khir. 2016, 54-57. PubMed ID: 27434957

This article reveals that the change of GPR149 will take part in the prostatic cancerogenesis, and GPR149 is a potential marker of prostatic cancer.
Edson M.A. and Lin Y. M. Deletion of the novel oocyte-enriched gene, Gpr149, leads to increased fertility in mice. Endocrinology. 2010, 151(1), 358. PubMed ID: 19887567

Authors of this article find that GPR149 null mice are viable and have normal folliculogenesis, but demonstrate increased fertility, enhanced ovulation, increased oocyte Gdf9 mRNA levels, and increased levels of FSH receptor and cyclin D2 mRNA levels in granulosa cells. GPR149 could be a target for small molecules to enhance fertility in the assisted reproductive technology clinic.
Edson M., et al. Functional studies of a novel oocyte-specific gene, gpr149. Biology of Reproduction. 2007, 76(1):92-92. PubMed ID: 28639411

Authors in this group perform functional analysis studies to determine the roles of GPR149 in oocyte physiology, and they suggest that GPR149 plays important roles in oocyte growth and maturation.

GPR149 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR149 antibody development services.

As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

Reference

Morri M, et al. (2018). Optical functionalization of human class A orphan g-protein-coupled receptors. Nature Communications. 9(1), 1950.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: