Introduction of GPR32
GPR32, also known as probable G-protein coupled receptor 32 or resolvin D1 receptor, is a protein which is encoded by the human GPR32 gene and belongs to the rhodopsin-like subfamily of G-protein coupled receptors. It was initially identified and defined as coding for an Orphan receptor, namely a protein with an amino acid sequence similar to known receptors but having no known ligand(s) to which it responds and no known function. During the past years, the role of GPR32 has been widely studied.
Basic Information of GPR32 | |
Protein Name | Probable G-protein coupled receptor 32 |
Gene Name | GPR32 |
Aliases | resolvin D1 receptor |
Organism | Homo sapiens (Human) |
UniProt ID | O75388 |
Transmembrane Times | 7 |
Length (aa) | 356 |
Sequence | MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMYYIVSRQWLLGEWACKLYITFVFLSYFASNCLLVFISVDRCISVLYPVWALNHRTVQRASWLAFGVWLLAAALCSAHLKFRTTRKWNGCTHCYLAFNSDNETAQIWIEGVVEGHIIGTIGHFLLGFLGPLAIIGTCAHLIRAKLLREGWVHANRPKRLLLVLVSAFFIFWSPFNVVLLVHLWRRVMLKEIYHPRMLLILQASFALGCVNSSLNPFLYVFVGRDFQEKFFQSLTSALARAFGEEEFLSSCPRGNAPRE |
Function of GPR32 Membrane Protein
As a member of the rhodopsin-like subfamily of G-protein coupled receptors, GPR32 is produced physiologically from the sequential oxygenation of docosahexaenoic acid (DHA) by 15- and 5-lipoxygenase and function to dampen excessive neutrophil trafficking to the site of inflammation. Studies have suggested that GPR32 can be expressed in various human cells, which including but not limited to neutrophils, lymphocytes, macrophages, and small airway epithelial cells. It has also been reported that GPR32 has the ability to inhibit the Cyclic adenosine monophosphate signaling pathway under both baseline and forskolin-stimulated conditions. Recently, a report described that RvD1 has the ability to suppress the EMT of A549 cells via ALX/FPR2 and GPR32 receptors, all of which lead to suppression of ZEB1 expression. Furthermore, research has found that triggering GPR32 could induce a pro-resolution macrophage phenotype with reduced secretion of proinflammatory cytokines, low chemotaxis, and increased phagocytosis of microbial particles.
Fig.1 Schematic view of the overall structure of a G protein-coupled receptor (GPCR). (Fossépré, 2014)
Application of GPR32 Membrane Protein in Literature
This article finds that serum level of resolvin D1 is elevated in both the attack and silent periods of familial Mediterranean fever (FMF) patients compared to controls. It indicates that resolvin D1 may be helpful to restrict inflammation.
This article suggests that RvD1 could inhibit the phosphorylation of TAK1 (TGF-β-activated kinase 1) by inhibiting the formation of a poly (I:C)-induced signaling complex composed of TAK1, TAB1 (TAK1 binding protein), and TRAF6 (TNF receptor-associated factor 6). It indicates that RvD1 has the potential to be used as an anti-inflammatory and pro-resolving agent, possibly in the context of exuberant host responses to damaging respirable agents such as viruses.
This article reveals that intramuscular diclofenac after endoscopic retrograde cholangiopancreatography can reduce the incidence of preventing pancreatitis, which may be related to the fact that diclofenac can increase the levels of LxA4, RvD1, and RvE1.
This article suggests that resolvin D1 has the ability to inhibit TGF-β1-induced EMT via ALX/FPR2 and GPR32 by reducing the expression of ZEB1.
This article indicates that RvD1 could specifically interact with both ALX and GPR32 on phagocytes and suggest that each plays a role in resolving acute inflammation.
GPR32 Preparation Options
To provide high-quality membrane protein products, we have developed a robust Magic™ membrane protein production platform which enables us to offer various flexible options. Our experienced scientists will work closely with you and help you find the most suitable approach to meet your specific requirements. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR32 antibody development services.
Equipped with world-leading technology platforms and professional scientific staff, Creative Biolabs is confident in assisting our clients with the most satisfactory membrane protein preparation services. If you are interested in the service we can provide, please don’t hesitate to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.