Introduction of GPR6
GPR6 is a protein encoded by the GPR6 gene which belongs to the G protein-coupled receptor family of transmembrane receptors. During the past years, GPR6 has been widely studied. It has been reported that GPR6 is both constitutively active but in addition is further activated by sphingosine-1-phosphate. And GPR6 could up-regulate cyclic AMP levels and promote neurite outgrowth.
Basic Information of GPR6 | |
Protein Name | G-protein coupled receptor 6 |
Gene Name | GPR6 |
Aliases | Sphingosine 1-phosphate receptor GPR6 |
Organism | Homo sapiens (Human) |
UniProt ID | P46095 |
Transmembrane Times | 7 |
Length (aa) | 377 |
Sequence | MTLLAWCTRGANPAAMNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV |
Function of GPR6 Membrane Protein
GPR6 belongs to the family of constitutively active Gs-coupled G protein-coupled receptors (GPCRs) that also includes GPR3 and GPR12. Based on the anatomical location of their expression, these receptors are involved in a wide array of functions such as neurite growth, amyloid processing, appetitive learning behavior and meiotic arrest of oocytes. And the diverse functions of this family of receptors appear to be mediated by their constitutive activity and their ability to maintain elevated intracellular cyclic AMP concentration. In the past years, the functions and applications of GPR6 have been widely studied. It has been reported that GPR6 is highly enriched in the striatal region of the adult mammalian brain, suggesting that this receptor may play a role in locomotor and/or reward-related behaviors. GPR6 knock-out mice don’t show overt locomotor aberration but showed an increased propensity to acquire appetitive learning behavior. Furthermore, GPR6 may also be expressed in intracellular compartments as GFP-tagged GPR6 was found predominantly between plasma membrane markers and nuclei.
Fig.1 G-protein-coupled receptor and G-protein. (Sontag, E. D.)
Application of GPR6 Membrane Protein in Literature
This article suggests that GPR6 is a novel molecular target for cannabidiol. It indicates that CBD could act as a novel inverse agonist on GPR6 and some of the potential therapeutic effects of CBD (e.g. treatment of Alzheimer's disease and Parkinson's disease) may be mediated through GPR6 receptors.
This article identifies pathways by which C1q, up-regulated in vivo early in response to injury without the coordinate induction of other complement components, can induce a program of gene expression that promotes neuroprotection and thus may provide protection against Aβ in preclinical stages of the AD and other neurodegenerative processes.
This report introduces a series of methods which can be used to detect cell surface expression and constitutive activity of GPR6.
This article suggests that GPR6 is primarily located in intracellular compartments. What’s more, it indicates that GPR6 can signal from intracellular compartments.
This article identifies the mouse orthologue of human GPR6 as a new member of the lysophospholipid-receptor family. It suggests that sphingosine-1-phosphate (S1P) could activate GPR6 with high specificity and nanomolar affinity.
GPR6 Preparation Options
During the past years, we have successfully established a powerful Magic™ membrane protein production platform for membrane protein preparation. Our experienced scientists are happy to help you accelerate the development of your projects. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR6 antibody development services.
With years of experience and professional scientists, Creative Biolabs is confident in offering the most satisfactory membrane protein preparation service to our worldwide clients. In addition to GPR6 membrane protein products, we also provide other membrane protein preparation services for worldwide customers. For more detailed information, please feel free to contact us and get a quote.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.