GPRC5C Membrane Protein Introduction

Introduction of GPRC5C

G-protein coupled receptor family C group 5 member C (GPRC5C) is a protein that in humans is encoded by the GPRC5C gene. GPRC5C protein is a member of the GPRC5 receptors, which are identified as a subfamily of the type 3 G protein-coupled receptor (GPCR) family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. Other members of type 3 GPCR family include metabotropic glutamate receptors, GABA_B receptors, calcium-sensing receptors, and pheromone receptors. However, in contrast to these receptors, the sequence analysis of GPRC5C has shown that this receptor has only short N-terminal domains.

Basic Information of GPRC5C
Protein Name	G-protein coupled family C group 5 member C
Gene Name	GPRC5C
Aliases	RAIG-3
Organism	Homo sapiens (Human)
UniProt ID	Q9NQ84
Transmembrane Times	7
Length (aa)	441
Sequence	MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAG IVTTFVLTIILVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRR FLFGVLFAICFSCLAAHVFALNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLV RGSGEGGPQGNSSAGWAVASPCAIANMDFVMALIYVMLLLLGAFLGAWPALCGRYKRWRK HGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTLAIALAANAWAFVLFYVIPEV SQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVAAKRPVSPYSG YNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQ AATPPKDGKNSQVFRNPYVWD

Functions of GPRC5C Membrane Protein

GPRC5Cs are found in peripheral tissues, such as the stomach, pancreas, kidneys, and liver. Moreover, it has been found to be developmentally regulated and differentially distributed in the brain. It has been suggested that this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. As a potential therapeutic target for different diseases, antagonists of this receptor remain to be developed for the prevention or treatment of different diseases. Currently, a comprehensive study of the structure and specific functions of this protein remains to be established.

GPRC5C Membrane Protein Introduction

Applications of GPRC5C Membrane Protein in Literature

Robbins M. J., et al. Molecular cloning and characterization of two novel retinoic acid-inducible orphan G-protein-coupled receptors (GPRC5B and GPRC5C). Genomics. 2000, 67(1): 8-18. PubMed ID: 10945465

This article investigated the distribution, expression, and the sequence information of the GPRC5C protein, which was identified as a member of retinoic acid-inducible receptors.
Sano T., et al. Comparative characterization of GPRC5B and GPRC5CLacZ knock in mice; behavioral abnormalities in GPRC5B-deficient mice. Biochemical & Biophysical Research Communications. 2011, 412(3): 460-5. PubMed ID: 21840300

This article studied the functions of GPRC5C in the GPRC5C-deficient mice and found that the expression of this receptor is developmentally regulated and differentially distributed in the brain. However, it does not affect the animal behavior.
Rajkumar P., et al. Identifying the localization and exploring a functional role for Gprc5c in the kidney. Faseb Journal. 2017: fj201700610RR. PubMed ID: 29196502

This article investigated the renal localization and physiologic parameters of GPRC5C in the GPRC5C-deficient mice. The results implied that GPRC5C modulated the renal contribution to systemic pH homeostasis.
Amisten S., et al. Anti-diabetic action of all-trans retinoic acid and the orphan G protein coupled receptor GPRC5C in pancreatic β-cells. Endocrine Journal. 2017, 64(3). PubMed ID: 28228611

This article found that pancreatic islets expressed high levels of GPRC5C and the agents activating GPRC5C may be a promising modality to treat or prevent diabetes by restoring and/or maintaining functional beta cell mass.

GPRC5C Preparation Options

Creative Biolabs offers a complete line of membrane protein preparation services utilizing various strategies and methods. A wide range of reconstitution systems in our Magic™ membrane protein production platform is available for you to choose from. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPRC5C antibody development services.

Our comprehensive membrane protein service covers every step of the production through purification and isolation and includes downstream processing to serve a variety of research requirements. Contact us for more details about our membrane protein preparation services.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: