Introduction of HRH3
Histamine H3 receptor (H3R or HRH3), is an integral membrane protein which in human is encoded by HRH3 gene. It is recognized as a histamine receptor belonging to the family of rhodopsin-like G-protein-coupled receptors. H3Rs are primarily expressed in the central nervous system and to a lesser extent the peripheral nervous system. The gene sequence for H3Rs expresses only about 22% and 20% homology with H1Rs and H2Rs respectively. Among all the four histamine receptors, H3R is distinguished for its almost exclusive expression in the nervous system and the large variety of isoforms generated by alternative splicing of the corresponding mRNA.
Basic Information of HRH3 | |
Protein Name | Histamine H3 receptor |
Gene Name | HRH3 |
Aliases | H3R, HH3R |
Organism | Homo sapiens (Human) |
UniProt ID | Q9Y5N1 |
Transmembrane Times | 7 |
Length (aa) | 453 |
Sequence |
MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFVADSSLRTQNN FFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTSSAFNIVLISYDRFLSVTRAV SYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGGSSIPEGHCYAEFFYNWYFLITASTLEFFTP FLSVTFFNLSIYLNIQRRTRLRLDGAREAAGPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEA AVGAEAGEATLGGGGGGGSVASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRL SRDRKVAKSLAVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWKKMKKKTCL |
Function of HRH3 Membrane Protein
Similar with all histamine receptors, H3R is coupled to the Gi G-protein, so it results in inhibition of the formation of cAMP. H3R acts as autoreceptors on histaminergic terminals and heteroreceptors inhibiting neurotransmitter release on other types of terminals, and also controls histamine turnover by feedback inhibition of histamine synthesis and release. H3Rs have also been indicated to presynaptically inhibit the release of a number of other neurotransmitters (i.e. it acts as an inhibitory heteroreceptor) including, but probably not limited to dopamine, GABA, acetylcholine, noradrenaline, histamine, and serotonin. Besides, H3Rs are considered to play a part in the control of satiety. Since its involvement in the neuronal mechanism behind many cognitive H3R-disorders and especially its location in the central nervous system, H3Rs has attracted great interests as a therapeutic target for the treatment of several important neurologic and psychiatric disorders, such as Alzheimer and Parkinson diseases, Gilles de la Tourette syndrome, and addiction.
Fig.1 H3-receptor activation can result in the modulation of diverse signaling pathways. (Leurs, 2005)
Application of HRH3 Membrane Protein in Literature
The findings of this article elucidated the role of H3 receptors in working memory and indicated the potential of H3 receptors as a therapeutic target for the cognitive impairments associated with neuropsychiatric disorders.
This study was carried out to investigate the influence of a histamine H3 receptor antagonist/inverse agonist in the high-fat and high-sugar diet-induced obesity model in mice and indicated that it had a favorable influence of body weight and improved glucose tolerance and the lipid profile in obese mice.
This article demonstrated the potential of non-imidazole H3R antagonists as novel antiepileptic drugs (AEDs) either for single use or in addition to currently available epilepsy medications.
Authors of this article have built an H3R biosensor which can visualize the activation of receptor through real-time structure changes and which can obtain pharmacological kinetic data at the same time. The FRET (fluorescence resonance energy transfer) signals may allow the sensor to become a useful tool for screening compounds and optimizing useful ligands.
The results indicated the potential involvement of H3Rs in modulating neurotransmitters related to neurodegenerative disorders, e.g., Alzheimer disease.
HRH3 Preparation Options
Our versatile Magic™ membrane protein production platform enables many flexible options, from which you can always find a better match for your particular project. To prepare the soluble and functional target protein of your interest, our experienced scientists we present robust reconstitution forms as well as multiple active formats for membrane proteins. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HRH3 antibody development services.
As one of the world top CROs, Creative Biolabs has worked all out in the field of membrane protein preparation to support membrane protein studies. We are able to provide the largest and most diverse portfolio of standard and custom professional membrane protein preparation services. Please feel free to contact us for professional technical support.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.