Introduction of HTR1F
5-hydroxytryptamine receptor 1F, also called serotonin receptor 1F, is one of the subtypes for serotonin receptor (5-HT receptor) which in human is encoded by HTR1F gene. It belongs to the G protein-coupled receptor (GPCR) family. HTR1F shares 61% sequence homology with the HTR1E receptor, which is the greatest among all the 5-HT receptors. HTR1Fs are found in spinal cord, mesentery, uterus, and brain, specifically in cortex, nucleus accumbens, striatum, amygdala, and hippocampus. And thus, HTR1F has supposed to be the subject of intense research as a target for anti-migraine drugs.
Basic Information of HTR1F | |
Protein Name | 5-hydroxytryptamine receptor 1F |
Gene Name | HTR1F |
Aliases | 5-HT-1F, 5-HT1F |
Organism | Homo sapiens (Human) |
UniProt ID | P30939 |
Transmembrane Times | 7 |
Length (aa) | 366 |
Sequence |
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDF LVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHA GIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAKT LYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRR QKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIF NEDFKKAFQKLVRCRC |
Function of HTR1F Membrane Protein
HTR1F or 5-HT1F acts as a receptor for the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT1F is suggested to be coupled to the inhibition of adenylyl cyclase. Activation of 5-HT1Fs in vivo is related to the inhibition of plasma extravasation in the dura, which is a component of neurogenic inflammation thought to be a possible cause of migraine. The activation of 5-HT1F receptors does not mediate constriction of human vasculature (unlike 5-HT1B/1D receptors), as this receptor is not present in blood vessels. Thus, 5-HT1F agonists would function without the unwanted cardiovascular side effects, which is a great advantage in the treatment of migraine. Furthermore, numerous preclinical studies have been indicated that the 5-HT1F mechanism seems to be primarily mediated by inhibition of pain signal transmission in the TNC (Tenascin C), in line with the central distribution of this receptor in the brainstem. Several 5-HT1F selective agonists have been developed with the hope that this mechanism could provide migraine headache relief by preventing pro-inflammatory neuropeptide release and interrupting pain signal transmission without vasoconstriction.
Fig.1 Signal transduction of 5-HT receptor subtypes. (Ohno, 2015)
Application of HTR1F Membrane Protein in Literature
The results showed the 5-HT1F receptor was a component of physiological MB regulation in the kidney and its absence potentiates renal injury and impedes recovery.
This study found that lasmiditan possessed a high lipophilicity, which suggested a direct action on the central descending antinociceptive pathways. Furthermore, since 5-HT1F receptors were located on trigeminal fibers, they could modulate CGRP release.
Authors of the study focused on the characterization of 5-HT1 receptor agonists and their effects as migraine therapies.
The findings indicated that the 5-HT1F receptor may be an effective therapeutic target for Parkinson's disease.
These results demonstrated the novel mechanisms of MB (mitochondrial biogenesis), which provided the foundation for new chemicals that induced MB to treat acute and chronic organ injuries.
HTR1F Preparation Options
Our efficient Magic™ membrane protein production platform is flexible to offer different options, which can meet the specific requirements of your research. To prepare the soluble and functional target protein of your interest, our experienced scientists are proud to offer customized services with fast turnaround times. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HTR1F antibody development services.
Creative Biolabs spares no effort to provide a comprehensive solution for membrane protein studies for our worldwide clients. In complement to our regular membrane protein preparation services, we also offer customized services based on the requirements of our clients. Please feel free to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.