Introduction of HTR2A
5-hydroxytryptamine receptor 2A, alternatively known as serotonin receptor 2A, is one of the subtypes for serotonin receptor (5-HT receptor) which in human is encoded by HTR2A gene. HTR2A is expressed postsynaptically to serotonergic neurons, and are particularly concentrated in the frontal cortex. It is also found in high density in the claustrum, a region which is connected to the visual cortex, in parts of the limbic system (i.e. amygdala and hippocampus), and in the basal ganglia. The high level of HTR2A expression throughout the cortex suggests that this 5-HT receptor subtype may be involved in higher cognitive or integrative functions.
Basic Information of HTR2A | |
Protein Name | 5-hydroxytryptamine receptor 2A |
Gene Name | HTR2A |
Aliases | 5-HT-2A, 5-HT2A |
Organism | Homo sapiens (Human) |
UniProt ID | P28223 |
Transmembrane Times | 7 |
Length (aa) | 471 |
Sequence |
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGCLSPSCLSLLHL QEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWP LPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVF GLQDDSKVFKEGSCLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFL PQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNE DVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKSSQLQM GQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV |
Function of HTR2A Membrane Protein
HTR2A or 5-HT2A belongs to a beta-arrestin family and acts as a receptor for the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). It inhibits the signaling via G proteins and mediates activation of alternative signaling pathways. When binding with its ligand, 5-HT2A causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors. Activation of 5-HT2A in the central nervous system leads to an increase in body temperature (hyperthermia) and increased secretion of ACTH. In the periphery, 5-HT2A mediates the contractile responses of vascular smooth muscle, and a component of the contractile response of smooth muscle in the gut, to 5-HT. And it may also play a role in arterial vasoconstriction. 5-HT2A signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that regulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca2+ ions from intracellular stores. It also has an impact on neural activity, perception, cognition, and mood, and thus can function as a receptor for various drugs and psychoactive substances.
Fig.1 Structure of 5-HT2A membrane protein.
Application of HTR2A Membrane Protein in Literature
The results showed that 5-HT2A receptor activation promoted phosphorylation of GluA2 AMPA receptor subunit at Ser880 and AMPA receptor internalization, indicating common mechanisms with electrically induced LTD (long-term depression).
This study found that increased autoantibodies in older adult diabetes with Parkinson's disease or dementia caused accelerated neuron loss via the 5-hydroxytryptamine 2 receptor coupled to inositol triphosphate receptor-mediated cytosolic Ca2+ release.
Authors in the study observed supersensitive coupling of 5-HT2AR toward inhibitory Gαi1-, Gαi3-, Gαo-, and Gαz-proteins after chronic THC exposure, without changes in the canonical Gαq/11-protein pathway.
The findings of this study indicated that job stress and 5-HTR2A receptor gene polymorphisms were associated with sleep quality in physicians.
Authors of this study concluded that treatment with fluoxetine promoted epileptogenesis in mice, but this effect was not mediated by 5-HT2A receptors.
HTR2A Preparation Options
Our Magic™ membrane protein production platform allows robust reconstitution forms as well as multiple active formats for membrane proteins. To prepare the soluble and functional target protein of your interest, our experienced scientists are willing to offer customized services with fast turnaround times. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HTR2A antibody development services.
Creative Biolabs is devoting to solve the toughest problems in membrane protein preparation by combining the most advanced technology around the world- and through that, we aim to accelerate access to a comprehensive solution for membrane protein studies for our worldwide clients. Please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.