HTR2B Membrane Protein Introduction

Introduction of HTR2B

5-hydroxytryptamine receptor 2B (5-HT2B), alternatively called serotonin receptor 2B, is a member of the 5-HT2 receptor for the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT2B is encoded by HTR2B gene in human. It has been found in the stomach fundus, intestine, kidney, heart, and lung, as well as in the brain, specifically in the cerebellum, cerebral cortex, amygdala, substantia nigra, caudate, thalamus, hypothalamus, and retina. HTR2B is also expressed in a number of blood vessels.

Basic Information of HTR2B
Protein Name	5-hydroxytryptamine receptor 2B
Gene Name	HTR2B
Aliases	5-HT-2B, 5-HT2B
Organism	Homo sapiens (Human)
UniProt ID	P41595
Transmembrane Times	7
Length (aa)	481
Sequence	MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGG NTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTAS IMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKER FGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAML DGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQ TTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSK FFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV

Function of HTR2B Membrane Protein

HTR2B or 5-HT2B is a beta-arrestin family member which inhibits signaling by G proteins and mediates activation of alternative signaling pathways. Similar to other 5-HT receptors, the binding of 5-HT2B and its receptor leads to a conformation change that triggers signaling through guanine nucleotide-binding proteins (G proteins) and regulates the activity of downstream effectors. 5-HT2B is involved in the regulation of dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake and in the regulation of extracellular dopamine and 5-hydroxytryptamine levels, and thus affects neural activity. Furthermore, 5-HT2B has an impact on the regulation of behavior, including impulsive behavior. It is required for normal proliferation of embryonic cardiac myocytes and normal heart development. And it also contributes to protecting cardiomyocytes against apoptosis. In addition, 5-HT2B also plays a role in the adaptation of pulmonary arteries to chronic hypoxia as well as in vasoconstriction. Given the vasodilatory role of the 5-HT2B receptor, recently developed 5-HT2B receptor antagonists may be indicated for the treatment of migraine.

Fig.1 Structure of 5-HT2B membrane protein.

Application of HTR2B Membrane Protein in Literature

Peng L., et al. Astroglial 5-HT2B receptor in mood disorders. Expert Rev Neurother. 2018, 30:1-8. PubMed ID: 29600729

The results showed that astroglial 5-HT2B receptors were linked to mood disorders and may represent a novel target for cell- and molecule-specific therapies of depression and mood disorders.
Belmer A. Positive regulation of raphe serotonin neurons by serotonin 2B receptors. Neuropsychopharmacology. 2018, 43(7):1623-1632. PubMed ID: 29453444

The observations of this study indicated that the 5-HT2B receptor acted as a direct positive modulator of serotonin Pet1-positive neurons in an opposite way as the known 5-HT1A-negative autoreceptor.
Szabo A., et al. Immunomodulatory capacity of the serotonin receptor 5-HT2B in a subset of human dendritic cells. Sci Rep. 2018, 8(1):1765. PubMed ID: 29379077

This article focused on the subset-specific expression and immunomodulatory function of 5-HT2B in human moDCs. The results expanded the biological role of 5-HT2B which may act not only as a neurotransmitter receptor, but also as an important modulator of both innate and adaptive immune responses.
Ohia S. E., et al. Serotonin-2B/2C receptors mediate bovine ciliary muscle contraction: role in intraocular pressure regulation. J Ocul Pharmacol Ther. 2018, 34(1-2):70-75. PubMed ID: 29364761

The findings of this study concluded that the 5-HT2B and 5-HT2C receptor subtypes appeared to be the predominant serotonin receptors that mediated the contractile action of this amine in bovine isolated ciliary muscles.
Hori A., et al. Regulatory mechanism of CCN2 production by serotonin (5-HT) via 5-HT2A and 5-HT2B receptors in chondrocytes. PLoS One. 2018, 12(11):e0188014. PubMed ID: 29145495

Authors of this study suggested that 5-HT promoted CCN2 production through the 5-HT2AR in growth plates and that it repressesed CCN2 production through the 5-HT2BR in articular cartilage for harmonized development of long bones.

HTR2B Preparation Options

To prepare the soluble and functional target protein of your interest, our experienced scientists are willing to offer customized services with fast turnaround times. Our Magic™ membrane protein production platform is flexible to offer different options, which can meet the specific requirements of your research. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HTR2B antibody development services.

Scientists in Creative Biolabs are devoting to offer values added services to our clients all over the world, in an attempt to help to achieve their research goal on membrane protein preparation. Please feel free to contact us for more details.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: