Introduction of LPAR6
LPAR6, encoded by LPAR6 gene, is a member of G-protein coupled receptor family and couples to G12/13, Gs and Gi. It is the most recently discovered LPAR subtype. LPAR6 is also known as P2Y5 because of sequence homology with P2Y receptors. The receptor is widely expressed in many human tissues, including placenta, fat, esophagus, gallbladder, prostate, urinary bladder and other 20 tissues, thus also indicating that it may possess diverse functions in the cell biological processes. It has shown that LPAR6 is associated with hypotrichosis. But most studies are required to investigate further functions of the receptor.
Basic Information of LPAR6 | |
Protein Name | Lysophosphatidic acid receptor 6 |
Gene Name | LPAR6 |
Aliases | LAH3, P2Y5, ARWH1, HYPT8, P2RY5 |
Organism | Homo sapiens (Human) |
UniProt ID | P43657 |
Transmembrane Times | 7 |
Length (aa) | 344 |
Sequence | MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA |
Function of LPAR6 Membrane Protein
LPAR6 is activated by LPA and stimulates intracellular signaling molecules actions, such as increased intracellular Ca2+, cAMP accumulation, and ERK1/2 activation, thereby transducing cell signaling pathway and inducing multiple cell effects. Several studies have shown that mutations in LPAR6 are associated with genetic hair loss and autosomal recessive hypotrichosis. It has been reported that lipase member H (LIPH) regulates hair follicle development by modulating epidermal growth factor receptor (EGFR) signaling pathway and LIPH mutations hypotrichosis patients are associated with decreased LPA production and reduced LPAR6 activation. These findings suggest that LPAR6 can be considered as a potential therapeutic target for hair loss. Besides, LPAR6 is involved in the progression of tumors. The study has indicated that the overexpression of LPAR6 is associated with high proliferation rates and poorer survival outcomes in hepatocellular carcinoma, thus uncovering the potential prognostic role in hepatocellular carcinoma treatment.
Fig.1 LPAR signaling and functional outcomes. (Stoddard, 2015)
Application of LPAR6 Membrane Protein in Literature
The study indicates that LPA1 and LPA6 may be involved in the regulation of the colony formation activity in DLD1 cells treated with anticancer drugs.
The study finds a novel homozygous frameshift variant (c.68_69dupGCAT; p.Phe24Hisfs*29) in the LPAR6 gene, which is associated with autosomal recessive woolly hair/hypotrichosis in consanguineous families.
The study finds that the inhibition of LPA4 and LPA6 can increase cell motile activities of DLD1 and HCT116 cells, as well as long-term 5-FU, treated cells.
The findings reveal that the higher LPA1 and LPA6 levels are found in the early-pregnant uterus, indicating their potential roles in pregnancy. And LPA6 plays a greater role in mediating LPA signaling in early pregnancy (29-42 days) of buffalo.
The findings indicate that biallelic loss-of-function variants (c.188A>T) in the LPAR6 gene induce hypotrichosis type 8, with or without woolly hair, a form of non-syndromic alopecia.
LPAR6 Preparation Options
Based on the versatile Magic™ membrane protein production platform, Creative Biolabs can provide many flexible options for soluble and functional target protein, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-LPAR6 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.