Close

Magic™ Membrane Protein Human AMHR2 (Anti-Mullerian hormone receptor type 2) Expressed in NS0 for Antibody Discovery, Partial (18-144aa) (CAT#: MPX0246K)

This product is a 40.2 kDa Human AMHR2 membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AMHR2
  • Protein Length
  • Partial (18-144aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 40.2 kDa
  • TMD
  • 1
  • Sequence
  • PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELP
    RAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHP
    SPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES

Product Description

  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in sterile PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • AMHR2
  • Full Name
  • Anti-Mullerian hormone receptor type 2
  • Introduction
  • This gene encodes the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • AMHR2; AMHR; MRII; MISR2; MISRII; anti-Muellerian hormone type-2 receptor; AMH type II receptor; MIS type II receptor; Muellerian inhibiting substance type II receptor; Mullerian inhibiting substance type II receptor; anti-Muellerian hormone type II receptor; anti-Mullerian hormone receptor, type II; Anti-Mullerian hormone receptor type 2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us