Close

Magic™ Membrane Protein Human FUT1 (Fucosyltransferase 1 (H blood group)) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX3857K)

This product is a Human FUT1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • FUT1
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • FUT1
  • Full Name
  • Fucosyltransferase 1 (H blood group)
  • Introduction
  • This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
  • Alternative Names
  • FUT1; H; HH; HSC; galactoside alpha-(1,2)-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H antigen; H glycosyltransferase; H glycosytransferase; alpha(1,2) fucosyltransferase 1; alpha(1,2)FT 1; blood group H alpha 2-fucosyltransferase; galactoside 2-L-fucosyltransferase enzyme; galactoside 2-alpha-L-fucosyltransferase; nonfunctional; fucosyltransferase 1; truncated FUT1; truncated alpha(1,2)fucosyltransferase; truncated fucosyltransferase 1; type 1 galactoside alpha-(1,2)-fucosyltransferase FUT1; type 2 galactoside alpha-(1,2)-fucosyltransferase FUT1; Fucosyltransferase 1 (H blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us