MRGPRD Membrane Protein Introduction

Introduction of MRGPRD

MRGPRD (MAS Related GPR Family Member D) belongs to a subfamily of G protein-coupled receptors (GPCRs) related to the MAS1 oncogene, including MRGD. MRGPRDs in humans, encoded by MRGPRD gene, are 7-transmembrane G-linked receptor proteins, possessing G-protein coupled receptor activity. The expression of a subset of MRGs was found predominantly in primary specific classes of sensory neurons and mast cells. As a novel GPCR family, MRGPR family consists of ∼40 members, which are classified into nine distinct subfamilies (MRGPRA to -H and -X).

Basic Information of MRGPRD
Protein Name	Mas-related G-protein coupled receptor member D
Gene Name	MRGPRD
Aliases	Beta-alanine receptor, G-protein coupled receptor TGR7
Organism	Homo sapiens (Human)
UniProt ID	Q8TDS7
Transmembrane Times	7
Length (aa)	321
Sequence	MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA

Function of MRGPRD Membrane Protein

In rodents, a core set of approximately four different genes (MrgA, MrgB, MrgC, and MrgD) contributes to Mrg sequence diversity, which defines a similar number of neuronal cell populations. Comparisons between mouse and human genomic may reveal differences atypical of rodents sometimes. Related researches have shown that MRGPR subtypes play an important role in nociception, pruritus, sleep, cell proliferation, circulation, and mast cell degranulation. MRGPRD protein may play a role in the regulation of nociceptor function and/or development, including the sensation or modulation of pain. MRGPRD acts as a specific membrane receptor for beta-alanine. It has been suggested that polymodal nociceptive neurons expressed MRGPRD and innervated mostly subpopulations of substantia gelatinosa neurons.

Fig.1 Schematic shows physiologic effects for MRGPRD in primary sensory DRG/ trigeminal ganglia (TG) neurons and blood vessels. (Solinski, 2014)

Application of MRGPRD Membrane Protein in Literature

Reynders A., et al. Transcriptional Profiling of Cutaneous MRGPRD Free Nerve Endings and C-LTMRs. Cell Rep. 2015, S2211-1247(15): 00047-9. PubMed ID: 25683706.

This article expands the molecular characterization of C-LTMRs by using a genetically marking C-LTMRs and MRGPRD+ neurons mouse model.
Qu L., et al. Enhanced excitability of MRGPRA3- and MRGPRD-positive nociceptors in a model of inflammatory itch and pain. Brain. 2014, 137(Pt 4):1039-50. PubMed ID: 24549959

This article reveals that the hyperexcitability of MRGPRA³⁺ and MRGPRD⁺ neurons may contribute to the spontaneous itch- and pain-related behaviors accompanying contact hypersensitivity and/or other inflammatory diseases in humans.
Shinohara T., et al. Identification of a G protein-coupled receptor specifically responsive to beta-alanine. J Biol Chem. 2004, 279: 23559-23564. PubMed ID: 15037633

This article confirms that MRGPRD mRNA is co-expressed in the small diameter neurons with P2X3 and VR1, both in rat and monkey dorsal root ganglia. Additionally, the report shows that MRGPRD plays a role in the modulation of neuropathic pain.
Zylka M.J., et al. Atypical expansion in mice of the sensory neuron-specific Mrg G protein-coupled receptor family. Proceedings of the National Academy of Sciences of the United States of America. 2003, 100: 10043-10048. PubMed ID: 12909716

This article suggests more generally that mouse-human genomic comparisons may sometimes reveal differences atypical of rodents.
Li H., et al. Identification of G protein-coupled receptor genes from the human genome sequence. FEBS Lett. 2002, 520: 97-101. PubMed ID: 12044878

This article identifies novel G protein-coupled receptors (GPCRs) with no introns in the coding region from the human genome sequence.

MRGPRD Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-MRGPRD antibody development services.

Creative Biolabs is equipped with world-leading technology platforms and professional scientific staff. We have successfully generated a variety of functional membrane protein targets for our worldwide customers. We are pleasant to tailor one-stop, custom-oriented service packages and provide lyophilization or freezing service for long-term storage of membrane proteins from weeks to months. Please feel free to contact us for more information.

Reference

Solinski H J, et al. (2014). Pharmacology and signaling of MAS-related G protein-coupled receptors. Pharmacol Rev. 66(3), 570-97.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: