Introduction of P2RY8
P2RY8 is encoded by the P2RY8 gene. It belongs to the G-protein-coupled receptor (GPCR) family which is the largest family of membrane-bound receptors and also the targets of many drugs. It is one of the nigh subtypes of purinergic receptors (P2RY1, P2RY2, P2RY4, P2RY6, P2RY8, P2RY11, P2RY12, P2RY13, and P2RY14). P2RY8 possesses seven transmembrane alpha helices as other GPCRs and is activated by adenosine and uridine nucleotides. However, the expression profile of P2RY8 has been rarely documented in humans.
Basic Information of P2RY8 | |
Protein Name | P2Y purinoceptor 8 |
Gene Name | P2RY8 |
Aliases | NA |
Organism | Homo sapiens (Human) |
UniProt ID | Q86VZ1 |
Transmembrane Times | 7 |
Length (aa) | 359 |
Sequence |
MQVPNSTGPDNATLQMLRNPAIAVALPVVYSLVAAVSIPGNLFSLWVLCRRMGPRSPSVIFMINLSVTDL MLASVLPFQIYYHCNRHHWVFGVLLCNVVTVAFYANMYSSILTMTCISVERFLGVLYPLSSKRWRRRRYA VAACAGTWLLLLTALSPLARTDLTYPVHALGIITCFDVLKWTMLPSVAMWAVFLFTIFILLFLIPFVITV ACYTATILKLLRTEEAHGREQRRRAVGLAAVVLLAFVTCFAPNNFVLLAHIVSRLFYGKSYYHVYKLTLC LSCLNNCLDPFVYYFASREFQLRLREYLGCRRVPRDTLDTRRESLFSARTTSVRSEAGAHPEGMEGATRP GLQRQESVF |
Function of P2RY8 Membrane Protein
P2RY8 functions as a transmembrane receptor, which preferentially binds to, and is activated by, adenosine and uridine nucleotides. The activity of P2RY8 is activated by adenosine and uridine nucleotides resulting in evoking the activation of adenylyl cyclase intracellular signaling pathway. Upon binding to nucleotides, P2RY8 can activate the extracellular signal-regulated kinases signaling pathway and the activation of phospholipase C. There are also some research papers show that the purinergic receptor signaling is involved in a variety of cellular responses, such as cell differentiation, cell migration, cell growth, and cell apoptosis. When it comes to screen the downstream components of P2RY8 signaling pathway in cells, the CREB and Elk-1 are activated by P2RY8, and the expression level of P2RY8 is upregulated after activation. Meanwhile, the transcriptional activities of the SRE, the c-Fos and c-Myc are regulated by P2RY8. The patients with a high expression level of P2RY8 have a higher risk of leukemogenesis than those with a lower expression level of P2RY8, so P2RY8 may have a contribution to leukemogenesis.
Fig.1 Schematic overview of the various mechanisms of P2RY membrane proteins. (Hechler, 2015).
Application of P2RY8 Membrane Protein in Literature
This article reports that P2RY8 has a possible contribution to the formation of leukemogenesis because of the higher expression level of P2RY8 in leukemia patients. P2RY8 may be a potential drug target for the treatment of leukemia.
This article reveals that P2RY8-CRLF2 fusion protein is an important indicator to the B-cell acute lymphoblastic leukemia because the expression pattern of P2RY8-CRLF2 fusion protein is correlated with the occurrence rate of B-cell acute lymphoblastic leukemia.
Authors in this group apply the genomic quantification method to analyze the P2RY8-CRLF2 positive leukemias, and the expression of P2RY8-CRLF2 fusion protein increases in B-cell precursor acute lymphoblastic leukemia patients.
This article focuses on the pharmacological role of P2RY8-CRLF2 fusion protein in pediatric B-cell precursor acute lymphoblastic leukemia and suggests that P2RY8-CRLF2 fusion protein is the most relevant prognostic factor in CRLF2 overexpression pediatric B-cell precursor acute lymphoblastic leukemia patients.
This article evaluates the overexpression of SOX5 is regulated by the P2RY8 promoter and the further studies indicate that SOX5 gene expression may be involved in the pathogenesis of primary splenic follicular lymphoma.
P2RY8 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-P2RY8 antibody development services.
Creative Biolabs has been at the forefront of functional membrane proteins research for many years, we have won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects in the field of membrane protein, Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.