SLC16A12 is also known as Monocarboxylate transporter 12 (MCT 12), Creatine transporter 2 (CRT2) and Solute carrier family 16 member 12. It belongs to the solute carrier family 16 member, SLC16 (or monocarboxylate transporter, MCT) family which shares characteristic sequence motifs. Meanwhile, the structure analysis indicates that SLC16A12 contains 12 transmembrane helices (TMs) with intracellular C- and N-termini and a large cytosolic loop between TMs 6 and 7. Meanwhile, SLC16A12 is also known as orphan transporter because its ligands have not been identified so far.
Basic Information of SLC16A12 | |
Protein Name | Monocarboxylate transporter 12 |
Gene Name | SLC16A12 |
Aliases | Creatine transporter 2, CRT2, Solute carrier family 16 member 12 |
Organism | Homo sapiens (Human) |
UniProt ID | Q6ZSM3 |
Transmembrane Times | 12 |
Length (aa) | 486 |
Sequence | MAKVNRARSTSPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYSFLLMSDFVVLAVSVLFMAYGCSPLFVYLVPYALSVGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVCYLFAVGMDGLCYLCLPMLQSLPLLVPFSCTFGYFDGAYVTLIPVVTTEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGRLVDTTGSYTAAFLLCGFSMIFSSVLLGFARLIKRMRKTQLQFIAKESDPKLQLWTNGSVAYSVARELDQKHGEPVATAVPGYSLT |
Based on the mutation analysis, the Monocarboxylate transporter 12 (MCT12) is likely to play a role in energy metabolism, since a premature termination codon in the gene SLC16A12 causes cataracts of the human lens and glucosuria with elevated and non-diabetic glucose levels in urine. In rats, SLC16A12 knockout (KO) animals did neither phenocopy the cataract nor the glucosuria phenotype, however, creatine levels in the urine were significantly elevated. KO male rats accumulated 5.85 mM creatine compared with 1.76 mM in age-matched heterozygous KO males, which corresponds to a ∼3-fold difference. Likewise, a ∼2-fold difference was measured in female rats with 2.12 mM creatine in KO animals versus 1.01 mM in age-matched wild-type siblings. Loss of SLC16A12 results in the retention of creatine in the urine and a single copy of the gene is sufficient for creatine transport. SLC16A12 is also reported to be involved in the establishment and/or maintenance of homeostasis in the lens and probably also in the kidney
Fig.1 Proposed structure of SLC16A12 membrane protein. (Halestrap, 2013)
This article reports that a non-synonymous alteration in MCT12 (p.G407S) found in a patient with age-related cataract (ARC) leads to a significant reduction of creatine transport. Furthermore, SLC16A12 knockout (KO) rats have elevated creatine levels in urine.
This article reveals that SLC16A12 is important for lens and kidney homeostasis and discusses its potential role in age-related cataract.
Authors in this article built a model whereby the SLC16A12 (c.643C>T) mutation causes juvenile cataract by a defect in protein trafficking rather than by haploinsufficiency and MCT12 was identified as another MCT isoform that requires CD147 for trafficking to the cell surface.
The authors in this article analyze SLC16A12 transcripts in surrogate tissue to demonstrate that the monocarboxylate transporter SLC16A12 may contribute to age-related cataract. Sequences within its 5’ UTR modulate translational efficiency with pathogenic consequences.
This article provides the first insight into the molecular requirements of monocarboxylate transporter 12 (MCT12), with particular emphasis on rescuing effects by its chaperone CD147, which can provide useful pharmacological information for substrate delivery.
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC16A12 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won a good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.