SLC24A3 (NCKX3) is a protein that widely exists in human. SLC24A3 encodes a protein of 644 amino acids that displays a high level of sequence identity to the other family members in the hydrophobic regions surrounding the “a-repeat” sequences. This sequence is thought to form the ion-binding pocket for transport. As anticipated from this sequence similarity, SLC24A3 displays K+-dependent Na+/Ca2+ exchanger activity when assayed in heterologous expression systems. The N-terminal region of SLC24A3 increases functional activity at least 10-fold and may represent a cleavable signal sequence. SLC24A3 transcripts are most abundant in the brain, with highest levels in selected thalamic nuclei, in hippocampal CA1 neurons, and in layer IV of the cerebral cortex. Many other tissues also express SLC24A3 at lower levels, but it is abundant in smooth muscle.
Basic Information of SLC24A3 | |
Protein Name | Solute carrier family 24 member 3 |
Gene Name | SLC24A3 |
Aliases | Na(+)/K(+)/Ca(2+)-exchange protein 3(NCKX3), Sodium/potassium/calcium exchanger 3 |
Organism | Homo sapiens (Human) |
UniProt ID | Q9HC58 |
Transmembrane Times | 10 |
Length (aa) | 644 |
Sequence | MRPSGDEDRARRRRRRRRRRDLLLSQLCFLASVALLLWSLSSLREQKELDLMDLVGEDRKWMMARKLMQVNDTLTSEDAGLRNSKNCTEPALHEFPNDIFTNEDRRQGAVVLHVLCAIYMFYALAIVCDDFFVPSLEKICERLHLSEDVAGATFMAAGSSAPELFTSVIGVFITKGDVGVGTIVGSAVFNILCIIGVCGLFAGQVVALSSWCLLRDSIYYTLSVIALIVFIYDEKVSWWESLVLVLMYLIYIVIMKYNACIHQCFERRTKGAGNMVNGLANNAEIDDSSNCDATVVLLKKANFHRKASVIMVDELLSAYPHQLSFSEAGLRIMITSHFPPKTRLSMASRMLINERQRLINSRAYTNGESEVAIKIPIKHTVENGTGPSSAPDRGVNGTRRDDVVAEAGNETENENEDNENDEEEEEDEDDDEGPYTPFDTPSGKLETVKWAFTWPLSFVLYFTVPNCNKPRWEKWFMVTFASSTLWIAAFSYMMVWMVTIIGYTLGIPDVIMGITFLAAGTSVPDCMASLIVARQGMGDMAVSNSIGSNVFDILIGLGLPWALQTLAVDYGSYIRLNSRGLIYSVGLLLASVFVTVFGVHLNKWQLDKKLGCGCLLLYGVFLCFSIMTEFNVFTFVNLPMCGDH |
SLC24A3 belongs to the NCKX family, which plays a critical role in Ca(2+) homeostasis in a wide variety of biological processes such as vision, olfaction, enamel formation, Melanocortin-4-receptor-dependent satiety, and skin pigmentation. It has been revealed that SLC24A3 mainly functions to transport one (Ca2+ + K+) in exchange for four Na+. So, it can influence calcium channel and symporter activity. SLC24A3 also regulates calcium ion, potassium ion and sodium ion binding in the physiological processes. Numerous biological processes, like cellular calcium ion homeostasis and ion transport, are also under the direction of SLC24A3. Depletion of the SLC24A3 gene in a KO mouse model showed loss of bone mineral contents and increased plasma parathyroid hormone, suggesting that SLC24A3 plays a role in regulating calcium homeostasis.
Fig.1 Role of SLC24A3 exchangers in mast cells. (Aneiros, 2005)
This article concludes the identification and characterization of NCKX3 (SLC24A3). Their findings expand the K(+)-dependent Na(+)/Ca(2+) exchanger family and show that the transporter has a more important role in cellular Ca(2+) handling than appreciated.
This article provides us with information about the structure and function of NCKX proteins. It helps us understand those proteins’ roles in neuronal Ca(2+) signaling.
This article shows that there are no significant differences in the function of all NCKX isoforms. So, the variation in the specific expression pattern of these exchangers is still unknown clearly.
These results indicate that NCKX3 is expressed within the human endometrium at the transcriptional and translational levels. Its expression level appears to be controlled by E2 during the human menstrual cycle.
This article presents three isoforms of NCKX family, NCKX2, NCKX3, and NCKX4. The relative potency of Cs+ and NH4+ in regulating NCKX2 is significantly better than those for NCKX3 and NCKX4, which means that the selectivity of NCKX2 for K+ is the weakest.
We have made great progress in membrane protein studies over the past few years. Based on our versatile Magic™ membrane protein production platform, we can offer you a series of membrane protein preparation services in reconstitution forms as well as multiple active formats worldwide. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC24A3 antibody development services.
During the past years, Creative Biolabs has successfully generated many functional membrane proteins for our global customers. It’s our pleasure to boost the development of our clients’ programs with our one-stop, custom-oriented service. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.