Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14), also known as Glucose transporter type 14 (GLUT-14), is a protein that in humans is encoded by the SLC2A14 gene. It is a member of the glucose transporter (GLUT) family, which consists of highly conserved integral membrane proteins that transport hexoses such as glucose and fructose into all mammalian cells.
Basic Information of SLC2A14 | |
Protein Name | Solute carrier family 2, facilitated glucose transporter member 14 |
Gene Name | SLC2A14 |
Aliases | Glucose transporter type 14, GLUT-14 |
Organism | Homo sapiens (Human) |
UniProt ID | Q8TDB8 |
Transmembrane Times | 12 |
Length (aa) | 535 |
Sequence | MQRLQLLRVEVLLGVKQGDEMRHFFFSSQTSTLEKSQNGGVGEEVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV |
As a member of the GLUTs family, SLC2A14 (GLUT14) contains 12 putative membrane-spanning helices along with sugar-transporter signature motifs that have previously been shown to be essential for sugar transport activity. To date, two alternatively spliced forms of GLUT14 have been identified, namely GLUT14-S and GLUT14-L. The shorter form of GLUT14 (GLUT14-S) consists of 10 exons and produces a 497-amino-acid protein that is 94.5% identical to GLUT3. The long form (GLUT14-L) has an additional exon and codes for a protein with 520 amino acids that differ from GLUT14-S only at the N-terminus. Studies have shown that GLUT14 is expressed in tissues other than testis and could play a role in the development of common disease such as leukemia and Parkinson’s disease. Furthermore, variations in the SLC2A14 locus are implicated in common diseases of the central nervous system, lymphatic cancer, rheumatoid arthritis, and intraocular pressure in primary open-angle glaucoma.
Fig.1 Schematic structure of GLUT family glucose transporter proteins. (Malenda, 2013)
This article aims to evaluate the involvement of the SLC2A14 polymorphism in the risk of developing late-onset Alzheimer's disease (LOAD) in Chinese. It suggests that SLC2A14 polymorphism has a possible role in changing the genetic susceptibility to LOAD in a Han Chinese population.
This article suggests that the GLUT family is probably emerged by gene duplications and mutations during evolution in different lineages.
This article suggests that detection of GLUT-1 and GLUT-14 is of high prognostic value, which gives additional information to UICC stages and identifies patients with an inferior prognosis.
To provide high-quality membrane protein products, we have developed an advanced Magic™ membrane protein production platform which enables many options, from which we will find you the perfect one. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-SLC2A14 antibody development services.
Creative Biolabs is confident in promoting global customers’ programs. In addition to SLC2A14 membrane protein products, we also provide other membrane protein preparation services to meet every client’s specific requirements. To learn more information, please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.