TACR2 Membrane Protein Introduction

Introduction of TACR2

TACR2 (Tachykinin Receptor 2), a G protein-coupled receptor, is encoded by TACR2 gene. TACR2 is a receptor for the tachykinin neuropeptide substance K, and it can interact with G proteins that activate a phosphatidylinositol-calcium second messenger system. Meanwhile, it is related to peptide ligand-binding receptors and GPCR signaling. Recent studies indicate that it is associated with many diseases, such as Retinitis Pigmentosa 68 and Asthma. It could be a potential diagnostic marker and therapeutic target in the clinic.

Basic Information of TACR2
Protein Name	Tachykinin receptor 2
Gene Name	TACR2
Aliases	NK2R, NKNAR, TAC2R
Organism	Homo sapiens (Human)
UniProt ID	P21452
Transmembrane Times	7
Length (aa)	398
Sequence	MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI

Function of TACR2 Membrane Protein

The TACR2 belongs to tachykinins receptor family. Various types of the 5'-end of the sequence of TACR2 gene provide the specific receptor affinities. In fact, TACR2 plays a significant role in gastrointestinal (GI) motility, secretion, and visceral sensitivity. Many diseases also have been proved to be related to the TACR2, including uterine leiomyomata, colorectal cancer, and Alzheimer's disease. The TACR2 receptor antagonists have been applied to clinical therapy.

TACR2 Membrane Protein Introduction Fig.1 Structure of Neurokinin A protein.

Application of TACR2 Membrane Protein in Literature

González-Santana A., et al. Altered expression of the tachykinins substance P/neurokinin A/hemokinin-1 and their preferred neurokinin 1/neurokinin 2 receptors in uterine leiomyomata. Fertility Sterility. 2016, 6: 1521-1529. PubMed ID: 27456549

This article reports that the expression levels of tachykinins and tachykinin receptors in uterine leiomyomas and matched myometrium.
Mao Y.L., et al. Human ablation of Tacr2 in mice leads to gastric emptying disturbance. Neurogastroenterol Motil. 2017, 29(11). PubMed ID: 28585346

This article investigates the effect of Tacr2 disruption in mice, and these results show that Tacr2 negatively regulate the expression of nNOS and VIP both in vivo and in vitro.
Pang M., et al. Transcriptomic profiles of brain provide insights into molecular mechanism of feed conversion efficiency in crucian carp (Carassius auratus). Int J Mol Sci. 2018, 19(3). PubMed ID: 29538345

Authors analyze the differentially expressed genes (DEGs) and feed conversion efficiency (FCE) in fish using RNA sequencing (RNA-Seq).
Zhang K., et al. The expression of tachykinin receptors in the human lower esophageal sphincter. Eur J Pharmacol. 2016, 774: 144-9. PubMed ID: 26852958

This article measures the mRNA and protein expression of TACR1, TACR2, and TACR3, and results show differences in expression between the different receptors within these muscle types, but the rank order of the receptor expression does not differ between the different muscle types.
Navarro V.M., et al. The integrated hypothalamic tachykinin-kisspeptin system as a central coordinator for reproduction. Endocrinology. 2015, 156(2): 627-37. PubMed ID: 25422875

Authors conducted a study in mice to assess the effects of specific activation of the receptors for SP and NKA in the central control of reproductive function in vivo.

TACR2 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TACR2 antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: