TACR3 Membrane Protein Introduction

Introduction of TACR3

TACR3 (Tachykinin Receptor 3), a G protein-coupled receptor, is encoded by TACR3 gene. TACR3 is a receptor for the tachykinin neuropeptide neuromedin-K (neurokinin B), and it can interact with G proteins that activate a phosphatidylinositol-calcium second messenger system. Meanwhile, several studies conducted on TACR3 indicate that its mutation can lead to a defect in the control of GnRH, and it plays a role in puberty onset and fertility in humans. TACR3 is regarded to relate with many diseases, such as bronchial hyperresponsiveness, airway inflammation, and cough. It could contribute to improving the treatment of reproductive disorders.

Basic Information of TACR3
Protein Name	Tachykinin receptor 3
Gene Name	TACR3
Aliases	NK3R,TAC3R
Organism	Homo sapiens (Human)
UniProt ID	P29371
Transmembrane Times	7
Length (aa)	465
Sequence	MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGL PVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVT NYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIA VDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEG PKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKM MIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLN KRFRAGFKRAFRWCPFIKVSSYDELELKTTRFHPNRQSSMYTVTRMESMTVVFDPNDADT TRSSRKKRATPRDPSFNGCSRRNSKSASATSSFISSPYTSVDEYS

Function of TACR3 Membrane Protein

The TACR3 belongs to tachykinins receptor family. Various types of the 5'-end of the sequence of TACR3 gene provide the specific receptor affinities. In fact, TACR3 plays a significant role in physiological development and specifically in the human reproductive system, and many diseases also have been proved to be related to the TACR3, including inflammatory bowel diseases, irritable bowel syndrome, squamous cell carcinoma, and gastrointestinal cancers.

Fig.1 Structure of G protein-coupled receptor.

Application of TACR3 Membrane Protein in Literature

Hero M., et al. GnRH receptor gene mutations in adolescents and young adults presenting with signs of partial gonadotropin deficiency. PLoS One. 2017, 12(11). PubMed ID: 29182666

This article studies the frequency of GNRHR, FGFR1, TAC3, and TACR3 mutations in nine adolescent and young adult females with clinical cues consistent with partial gonadotropin deficiency, and results show that genetic testing of the GNRHR gene should be necessary to reduce the risk of disease.
Padua D.M., et al. Human role of G protein-coupled receptors-microRNA interactions in gastrointestinal pathophysiology. Am J Physiol Gastrointest Liver Physiol. 2017, 313(5): 361-372. PubMed ID: 28774868

This article reviews recent research on GPCR-miRNA interactions related to gastrointestinal pathophysiology, and try to identify the potential biomarkers for gastrointestinal diseases.
Crandall C.J., et al. Association of genetic variation in the tachykinin receptor 3 locus with hot flashes and night sweats in the Women's Health Initiative Study. Menopause. 2017, 24(3): 252-261. PubMed ID: 28231077

Authors analyze the data from three genome-wide association studies and find genetic variation in TACR3 may contribute to the risk of Vasomotor symptoms.
Obata K., et al. Tachykinin receptor 3 distribution in human oral squamous cell carcinoma. Anticancer Res. 2016, 36(12): 6335-6341. PubMed ID: 27919954

This article examines the expression pattern of TAC3/TACR3 in clinically-resected oral squamous cell carcinoma samples, and the data show TACR3 in the bone matrix can affect gingival oral squamous cell carcinoma cells.
Qi X., et al. The neurokinin B exerts direct effects on the ovary to stimulate estradiol production. Endocrinology. 2016, 157(9): 3355-65. PubMed ID: 27580802

Authors conduct a study in zebrafish to determine whether NKB acts directly on the ovary to regulate reproduction, and they find NK3R mRNA is strongly down-regulated in granulosa cells obtained from polycystic ovary syndrome (PCOS) patients, which can be useful for the PCOS therapy.

TACR3 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TACR3 antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: