TMEM150C Membrane Protein Introduction

Introduction of TMEM150C

Transmembrane protein 150C (TMEM150C), also known as Tentonin 3 (TTN3), is a transmembrane protein encoded by the TMEM150C/TTN3 gene. TMEM150C/Tentonin 3 consists of 249 amino acids and is predicted to have six transmembrane domains. Mechanosensation, which is mediated by mechanotransduction channels, is a fundamental function required for the survival of vertebrates. The study found that TMEM150C/Tentonin 3 is a new class of mechanotransduction channel. Surprisingly, TMEM150C is expressed in muscle spindle afferents. Since genetic ablation of TMEM150C reduces motor coordination, TMEM150C appears to contribute to proprioception. Therefore, the cloning and expression of TMEM150C can be used to understand various other mechanotransduction mechanisms.

Basic Information of TMEM150C
Protein Name	Transmembrane protein 150C
Gene Name	TMEM150C
Organism	Homo sapiens (Human)
UniProt ID	B9EJG8
Transmembrane Times	6
Length (aa)	249
Sequence	MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDDKILPLNSAERKPGVKHAPYISIAGDDPPASCVFSQVMNMAAFLALVVAVLRFIQLKPKVLNPWLNISGLVALCLASFGMTLLGNFQLTNDEEIHNVGTSLTFGFGTLTCWIQAALTLKVNIKNEGRRVGIPRVILSASITLCVVLYFILMAQSIHMYAARVQWGLVMCFLSYFGTFAVEFRHYRYEIVCSEYQENFLSFSESLSEASEYQTDQV

The Function of TMEM150C Membrane Protein

The somatosensory ganglia of vertebrates contain various types of mechano-sensitive neurons and neuronal mechano-sensitivity relies on mechano-gated ion channels. Due to the presence of mechano-gated ion channels, these neurons can convert mechanical stimuli into ionic currents, including non-selective excitation channels such as Piezo2 and potassium selective inhibition channels such as TREK-1. Numerous studies have demonstrated that TMEM150C is proposed to mediate mechano-activated current in proprioceptive neurons. TMEM150C can interact with mechano-gated ion channels from different classes (Piezo2, Piezo1, and the potassium channel TREK-1). TMEM150C significantly prolongs the duration of the mechano-current produced by three channels (Piezo2, Piezo1, and the potassium channel TREK-1), reduces apparent activation threshold in Piezo2 and induces the persistent current in Piezo1. Therefore, the TMEM150C is a general regulator of mechano-gated ion channels from different classes. Moreover, TMEM150C is co-expressed with Piezo2 in trigeminal neurons, expanding its role beyond proprioceptors.

Fig.1 A putative topology of TMEM150C predicted by the TMHMM program. Each dot represents an amino acid in mouse TMEM150C. (Hong, 2016)

Application of TMEM150C Membrane Protein in Literature

Anderson E.O., et al. TMEM150C/Tentonin3 Is a Regulator of Mechano-gated Ion Channels. Cell Reports. 2018, 23(3):701-708. PubMed ID: 29669276

This article reveals that TMEM150C is a general regulator of mechano-gated ion channels from different classes.
Hong G.S., et al. Evidence for Mechanosensitive Channel Activity of Tentonin3/TMEM150C. Neuron. 2017, 94(2):271-273.e2. PubMed ID: 28426962

This study supports that TTN3 is a pore-forming unit rather than an amplification aptamer for Piezo1 activity.
Hong G.S., et al. Tentonin3/TMEM150c Confers Distinct Mechanosensitive Currents in Dorsal-Root Ganglion Neurons with Proprioceptive Function. Neuron. 2016, 91(3):708-710. PubMed ID: 27497226

This article shows that TTN3/TMEM150C is a component of mechanically sensitive channels with a slow rate of inactivation and contributes to motor coordination.
Mrschtik M. Characterisation of the role of DRAM-related TMEM150 proteins in cancer cell survival, cell death and autophagy. University of Glasgow. 2016.

This study demonstrates that the effect of the DRAM family member TMEM150B on the autophagy process is not related to its ability to regulate survival in glucose-starved cells.

TMEM150C Preparation Options

Membrane protein research has made great progress in recent years. Based on our versatile Magic™ membrane protein production platform, we offer a range of membrane protein preparation services to our global customers. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-TMEM150C antibody development services.

Creative Biolabs has successfully produced many functional membrane proteins for our global customers during the past years. We are pleased to accelerate the development of our client program through our customized services. For more detailed information, please feel free to contact us.

Reference

Hong G S, et al. (2016). Tentonin 3/TMEM150c Confers Distinct Mechanosensitive Currents in Dorsal-Root Ganglion Neurons with Proprioceptive Function. Neuron. 91(1).

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: