CACNG5 Membrane Protein Introduction

Introduction of CACNG5

Encoded by CACNG5 gene, CACNG5 belongs to the neuronal calcium channel gamma subunit subfamily which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. It is one of the five subunits of L-type calcium channels. Recent studies show it is associated with bipolar disorder and schizophrenia.

Basic Information of CACNG5
Protein Name	Voltage-dependent calcium channel gamma-5 subunit
Gene Name	CACNG5
Aliases	NA
Organism	Homo sapiens (Human)
UniProt ID	Q9UF02
Transmembrane Times	4
Length (aa)	275
Sequence	MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC

Function of CACNG5 Membrane Protein

Mapping to chromosome 17q24, CACNG5 gene encodes an integral membrane protein that was originally isolated as the regulatory gamma subunit of voltage-dependent Ca²⁺ channels. As a type II transmembrane AMPA receptor regulatory protein (TARP), CACNG5 can regulate the gating properties of AMPA-selective glutamate receptors (AMPARs) by accelerating their rates of activation, deactivation, and desensitization. It is commonly expressed in lots of tissues, such as the brain, lymph node, as well as spleen. Recent studies show that it may contribute to the risk of schizophrenia. It is documented that the lncRNA LINC00880 targeting CACNG5 can inhibit cell apoptosis and promote proliferation, migration, and invasion in spinal cord ependymoma (SCE) through the MAPK signaling pathway.

Fig.1 Structure of p38 MAPK Pathway.

Application of CACNG5 Membrane Protein in Literature

Wu D.M., et al. LncRNA LINC00880 promotes cell proliferation, migration, and invasion while inhibiting apoptosis by targeting CACNG5 through the MAPK signaling pathway in spinal cord ependymoma. J Cell Physiol. 2018, 233(9): 6689-6704. PubMed ID: 29215699

This article analyses the positive expression of the CACNG5 protein, LINC00880, and MAPK signaling pathway-related proteins in spinal cord ependymoma (SCE) tissues. These results demonstrate that lncRNA LINC00880 targeting CACNG5 inhibits cell apoptosis and promotes proliferation, migration, and invasion in SCE through the MAPK signaling pathway.
Guan F., et al. Evaluation of voltage-dependent calcium channel γ gene families identified several novel potential susceptible genes to schizophrenia. Sci Rep. 2016, 6: 24914. PubMed ID: 27102562

Authors conduct a large-scale association study in Han Chinese individuals. The data suggest the SNP rs17645023 located in the intergenic region of CACNG4 and CACNG5 is identified to be significantly associated with schizophrenia.
Curtis D., et al. Case-case genome-wide association analysis shows markers differentially associated with schizophrenia and bipolar disorder and implicates calcium channel genes. Psychiatr Genet. 2011, 21(1): 1-4. PubMed ID: 21057379

Authors in this group conduct genome-wide association studies and compare marker allele frequencies between the samples of UK bipolar and schizophrenic. These results indicate that CACNG5 plays a key role in voltage-dependent calcium channel genes in the susceptibility to bipolar disorder and/or schizophrenia.

CACNG5 Preparation Options

To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-CACNG5 antibody development services.

As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: