Mouse Anti-Human Complement C1QA Polyclonal Antibody(Cat#: CTA-355)

This product is an unconjugated anti-Human Complement C1QA Polyclonal antibody generated from the Mouse. The antibody can be used for WB.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Mouse
Isotype IgG
Immunogen C1QA (23 a.a. - 245 a.a.) full-length human protein. EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
Species Reactivity Human
Applications WB
Application Notes The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement C1QA.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 50 µg
Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name C1QA
Alternative Names Complement C1q A Chain; Complement Component 1, Q Subcomponent, Alpha Polypeptide; Complement Component 1, Q Subcomponent, A Chain; Complement C1q Chain A; Complement C1q Subcomponent Subunit A; Complement Component C1q, A Chain
Gene ID 712
UniProt ID P02745
Information
Introduction Complement C1q subcomponent subunit A is a protein that in humans is encoded by the C1QA gene. C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry