Mouse Anti-Human Complement C1QB Polyclonal Antibody(Cat#: CTA-362)

This product is an unconjugated anti-Human Complement C1QB Polyclonal antibody generated from the Mouse. The antibody can be used for WB; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

Summary Related Products & Services

Specifications
Clonality Polyclonal
Host Animal Mouse
Isotype IgG
Immunogen C1QB (1 a.a. - 253 a.a.) full-length human protein. MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Species Reactivity Human
Applications WB; IHC
Application Notes WB: 1:100-1:2000
IHC: 1:10-1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human complement C1QB.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 20; 100 µL
Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name C1QB
Alternative Names Complement C1q B Chain; Complement Component 1, Q Subcomponent, Beta Polypeptide; Complement Component 1, Q Subcomponent, B Chain; Complement C1q Subcomponent Subunit B; Complement C1q Chain B; Complement Subcomponent C1q Chain B; Complement Component C1q, B Chain; C1QB
Gene ID 713
UniProt ID P02746
Information
Introduction C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry