Rabbit Anti-Human CD59 Polyclonal Antibody(Cat#: CTA-520)

This product is an anti-Human CD59 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IF; IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

Summary Related Products & Services
Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
Species Reactivity Human
Applications WB; IF; IHC
Application Notes WB: 0.04-0.4 µg/mL
IF: 0.25-2 µg/mL
IHC: 1:500 - 1:1000
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human CD59.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name CD59
Alternative Names T cell-activating protein; 16.3A5; 1F5 antigen; 1F5; 20 kDa homologous restriction factor; CD59 antigen p18-20 (antigen identified by; monoclonal antibodies 16.3A5; EJ16; CD59 antigen; CD59 antigen; complement regulatory protein; CD59 glycoprotein; CD59 molecule; complement regulatory protein; CD59; EJ16; EJ30; EJ30; EL32 and G344); EL32; FLJ38134; FLJ92039; G344; HRF20; HRF-20; human leukocyte antigen MIC11; Ly-6-like protein; lymphocytic antigen CD59/MEM43; MACIF; MAC-inhibitory protein; MAC-IP; MEM43 antigen; MEM43; membrane attack complex (MAC) inhibition factor; Membrane attack complex inhibition factor; Membrane inhibitor of reactive lysis; MGC2354; MIC11; MIC11MSK21; MIN1; MIN2; MIN3; MIRL; p18-20; Protectin; surface anitgen recognized by monoclonal 16.3A5
Gene ID 966
UniProt ID P13987
Information
Introduction CD59 glycoprotein, also known as MAC-inhibitory protein (MAC-IP), membrane inhibitor of reactive lysis (MIRL), or protectin, is a protein that in humans is encoded by the CD59 gene. It belongs to the LY6/uPAR/alpha-neurotoxin protein family. CD59 attaches to host cells via a glycophosphatidylinositol (GPI) anchor. When complement activation leads to deposition of C5b678 on host cells, CD59 can prevent C9 from polymerizing and forming the complement membrane attack complex. It may also signal the cell to perform active measures such as endocytosis of the CD59-CD9 complex. Mutations affecting GPI that reduce expression of CD59 and decay-accelerating factor on red blood cells result in paroxysmal nocturnal hemoglobinuria. Viruses such as HIV, human cytomegalovirus and vaccinia incorporate host cell CD59 into their own viral envelope to prevent lysis by complement.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry