Rabbit Anti-Human CFHR2 Polyclonal Antibody(Cat#: CTA-412)

This product is an unconjugated anti-Human CFHR2 Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

Summary Related Products & Services


Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: KLKWTNQQKLYSRTGDIVEFVCKSGYHPTKSHSFRAMCQNGKLVYPSCEE
Species Reactivity Human
Applications IHC
Application Notes IHC: 1:50 - 1:200
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human CFHR2.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name CFHR2
Alternative Names Complement Factor H Related 2; H Factor (Complement)-Like 3; H Factor-Like Protein 2; H Factor-Like 3; DDESK59; CFHL2; FHR-2; HFL3; FHR2; Complement Factor H-Related Protein 2; Complement Factor H-Related 2; Factor H-Related Gene 2
Gene ID 3080
UniProt ID P36980
Information
Introduction Complement factor H-related protein 2 is a protein that in humans is encoded by the CFHR2 gene. Involved in complement regulation. The dimerized forms have avidity for tissue-bound complement fragments and efficiently compete with the physiological complement inhibitor CFH. Can associate with lipoproteins and may play a role in lipid metabolism.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry