Rabbit Anti-Human Clusterin Polyclonal Antibody(Cat#: CTA-423)

This product is an unconjugated anti-Human Clusterin Polyclonal antibody generated from the Rabbit. The antibody can be used for IHC.

Certificate of Analysis Lookup

To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.

Lot Number

Summary Related Products & Services


Specifications
Clonality Polyclonal
Host Animal Rabbit
Isotype IgG
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: SSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNS
Species Reactivity Human
Applications IHC
Application Notes IHC: 1:200 - 1:500
The optimal working dilutions should be determined by the end user.
Specificity This antibody reacts with Human Clusterin.
Purity ≥95% as determined by SDS-PAGE
Format Liquid
Size 25; 100 µL
Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Type Primary Antibody
Target
Target Name Clusterin
Alternative Names Testosterone-Repressed Prostate Message;Clusterin (Complement Lysis Inhibitor, SP-40,40, Sulfated Glycoprotein 2, Testosterone-Repressed Prostate Message 2, Apolipoprotein J); ; Apolipoprotein J; Complement-Associated Protein SP-40,40; Complement Cytolysis Inhibitor; Complement Lysis Inhibitor; Sulfated Glycoprotein 2; Ku70-Binding Protein 1; NA1/NA2; TRPM-2; APOJ; KUB1; CLI; Aging-Associated Gene 4 Protein; Aging-Associated Protein 4; APO-J; SGP-2; SP-40; TRPM2; Apo-J; AAG4; CLU1; CLU2; SGP2
Gene ID 1191
UniProt ID P10909
Information
Introduction Clusterin (apolipoprotein J) is a 75 - 80 kDa disulfide-linked heterodimeric protein associated with the clearance of cellular debris and apoptosis. In humans, clusterin is encoded by the CLU gene on chromosome 8. CLU is a molecular chaperone responsible for aiding protein folding of secreted proteins, and its three isoforms have been differentially implicated in pro- or antiapoptotic processes. Through this function, CLU is involved in many diseases related to oxidative stress, including neurodegenerative diseases, cancers, inflammatory diseases, and aging. CLU is a member of the small heat shock protein family and, thus, a molecular chaperone. Unlike most other chaperone proteins, which aid intracellular proteins, CLU is a Golgi chaperone that facilitates the folding of secreted proteins in an ATP-independent way.
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
Online Inquiry