Rabbit Anti-Human CR2 Polyclonal Antibody(Cat#: CTA-476)
This product is an anti-Human CR2 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
Summary
Related Products & Services
Specifications
| Clonality |
Polyclonal |
| Host Animal |
Rabbit |
| Isotype |
IgG |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS |
| Species Reactivity |
Human |
| Applications |
WB; IHC |
| Application Notes |
WB: 0.04-0.4 µg/mL
IHC: 1:200 - 1:500
The optimal working dilutions should be determined by the end user. |
| Specificity |
This antibody reacts with Human CR2. |
| Purity |
≥95% as determined by SDS-PAGE |
| Format |
Liquid |
| Size |
25; 100 µL |
| Storage |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Type |
Primary Antibody |
Target
| Target Name |
CR2 |
| Alternative Names |
Complement C3d Receptor 2; Complement Component (3d/Epstein Barr Virus) Receptor 2; Complement Component 3d Receptor 2; Epstein-Barr Virus Receptor; EBV Receptor; Complement C3d Receptor; CD21 Antigen; Cr2; CR; C3DR; CD21; CVID7; SLEB9 |
| Gene ID |
1380 |
| UniProt ID |
P20023 |
Information
| Introduction |
omplement receptor type 2 (CR2), also known as complement C3d receptor, Epstein-Barr virus receptor, and CD21 (cluster of differentiation 21), is a protein that in humans is encoded by the CR2 gene. CR2 is involved in the complement system. It binds to iC3b (inactive derivative of C3b), C3dg, or C3d. B cells have CR2 receptors on their surfaces, allowing the complement system to play a role in B-cell activation and maturation. it is receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells and for HNRNPU, and participates in B lymphocytes activation |
For Research Use Only. Not for Diagnostic or Therapeutic Applications.
