This product is an anti-Human CR2 Polyclonal antibody generated from the Rabbit. The antibody can be used for WB; IHC.
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Clonality | Polyclonal |
Host Animal | Rabbit |
Isotype | IgG |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS |
Species Reactivity | Human |
Applications | WB; IHC |
Application Notes | WB: 0.04-0.4 µg/mL IHC: 1:200 - 1:500 The optimal working dilutions should be determined by the end user. |
Specificity | This antibody reacts with Human CR2. |
Purity | ≥95% as determined by SDS-PAGE |
Format | Liquid |
Size | 25; 100 µL |
Storage | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Type | Primary Antibody |
Target Name | CR2 |
Alternative Names | Complement C3d Receptor 2; Complement Component (3d/Epstein Barr Virus) Receptor 2; Complement Component 3d Receptor 2; Epstein-Barr Virus Receptor; EBV Receptor; Complement C3d Receptor; CD21 Antigen; Cr2; CR; C3DR; CD21; CVID7; SLEB9 |
Gene ID | 1380 |
UniProt ID | P20023 |
Introduction | omplement receptor type 2 (CR2), also known as complement C3d receptor, Epstein-Barr virus receptor, and CD21 (cluster of differentiation 21), is a protein that in humans is encoded by the CR2 gene. CR2 is involved in the complement system. It binds to iC3b (inactive derivative of C3b), C3dg, or C3d. B cells have CR2 receptors on their surfaces, allowing the complement system to play a role in B-cell activation and maturation. it is receptor for complement C3Dd, for the Epstein-Barr virus on human B-cells and T-cells and for HNRNPU, and participates in B lymphocytes activation |