Close

Magic™ Membrane Protein Human ATP6V0B (ATPase H+ transporting V0 subunit b) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2190K)

This product is a Human ATP6V0B membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP6V0B
  • Protein Length
  • Full Length
  • Protein Class
  • Transport
  • TMD
  • 5
  • Sequence
  • MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ATP6V0B
  • Full Name
  • ATPase H+ transporting V0 subunit b
  • Introduction
  • This gene encodes a portion of the V0 domain of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. Activity of this enzyme is necessary for such varied processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • ATP6V0B; ATP6F; HATPL; VMA16; V-type proton ATPase 21 kDa proteolipid subunit; ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b; ATPase, H+ transporting, lysosomal, 21-KD, V0 subunit C-prime, prime; ATPase, H+ transporting, lysosomal, subunit F; H(+)-transporting two-sector ATPase, subunit F; V-ATPase 21 kDa proteolipid subunit; V-ATPase subunit b; V-ATPase subunit c''; vacuolar ATP synthase 21 kDa proteolipid subunit; vacuolar proton pump 21 kDa proteolipid subunit; ATPase H+ transporting V0 subunit b

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us