Close

Magic™ Membrane Protein Human TSPAN7 (Tetraspanin 7) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (113-213aa) (CAT#: MPX4481K)

This product is a 15.6kDa Human TSPAN7 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TSPAN7
  • Protein Length
  • Partial (113-213aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 15.6kDa
  • TMD
  • 4
  • Sequence
  • RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • TSPAN7
  • Full Name
  • Tetraspanin 7
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked cognitive disability and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy.
  • Alternative Names
  • TSPAN7; A15; MXS1; CD231; MRX58; CCG-B7; TM4SF2; TALLA-1; TM4SF2b; DXS1692E; tetraspanin-7; CD231 antigen; T-cell acute lymphoblastic leukemia associated antigen 1; cell surface glycoprotein A15; membrane component chromosome X surface marker 1; membrane component, X chromosome, surface marker 1; tetraspanin protein; transmembrane 4 superfamily 2b; transmembrane 4 superfamily member 2; transmembrane protein A15; tspan-7; Tetraspanin 7

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email: info@creative-biolabs.com
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us