Close

Magic™ Membrane Protein Human HLA-E (Major histocompatibility complex, class I, E) Expressed in Baculovirus/Insect expression system with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (22-305aa) (CAT#: MPX4676K)

This product is a 36.7 kDa Human HLA-E membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • HLA-E
  • Protein Length
  • Partial (22-305aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 36.7 kDa
  • TMD
  • 1
  • Sequence
  • GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQPTIPI

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • HLA-E
  • Full Name
  • Major histocompatibility complex, class I, E
  • Introduction
  • HLA-E belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-E binds a restricted subset of peptides derived from the leader peptides of other class I molecules. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail.
  • Alternative Names
  • HLA-E; QA1; HLA-6.2; HLA class I histocompatibility antigen, alpha chain E; MHC class I antigen E; MHC class Ib antigen; Major histocompatibility complex, class I, E

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us